Hill Country Listings | Central Texas Real Estate – Homes, Ranches & Investments logo
  • Property Search
  • Featured listings
  • Areas
    • Blanco
    • Canyon Lake
    • Fischer
    • New Braunfels
    • San Marcos
    • Wimberley
  • About
  • Contact
stormy.sparkman@hotmail.com
Sign In
Sign Up
Hill Country Listings | Central Texas Real Estate – Homes, Ranches & Investments logo
  • Property Search
  • Featured listings
  • Areas
    • Blanco
    • Canyon Lake
    • Fischer
    • New Braunfels
    • San Marcos
    • Wimberley
  • About
  • Contact
stormy.sparkman@hotmail.com
Sign In
Sign Up
Hill Country Listings | Central Texas Real Estate – Homes, Ranches & Investments logo
  • Property Search
  • Featured listings
  • Areas
    • Blanco
    • Canyon Lake
    • Fischer
    • New Braunfels
    • San Marcos
    • Wimberley
  • About
  • Contact
stormy.sparkman@hotmail.com
Sign In
Sign Up
Hill Country Listings | Central Texas Real Estate – Homes, Ranches & Investments logo
Save Search
City, zip, neighborhood, address…
Loading in progress…
No results found
Type in anything you’re looking for
Min
Min$250$500$750$1,000$1,250$1,500$1,750$2,000$2,250$2,500$2,750$3,000$3,250$3,500$3,750$4,000$4,250$4,500$4,750$5,000$5,500$6,000$6,500$7,000$7,500$8,000$8,500$9,000$9,500$10,000$10,500$11,000$11,500$12,000$12,500$13,000$13,500$14,000$14,500$15,000$16,000$18,000$20,000$25,000$30,000$35,000$40,000$45,000$50,000$100,000$125,000$150,000$175,000$200,000$225,000$250,000$275,000$300,000$325,000$350,000$375,000$400,000$425,000$450,000$475,000$500,000$525,000$550,000$575,000$600,000$625,000$650,000$675,000$700,000$725,000$750,000$775,000$800,000$825,000$850,000$875,000$900,000$925,000$950,000$975,000$1,000,000$1,100,000$1,200,000$1,300,000$1,400,000$1,500,000$1,600,000$1,700,000$1,800,000$1,900,000$2,000,000$2,250,000$2,500,000$2,750,000$3,000,000$3,250,000$3,500,000$3,750,000$4,000,000$4,250,000$4,500,000$4,750,000$5,000,000$7,500,000$10,000,000$12,500,000$15,000,000$20,000,000$25,000,000$30,000,000$35,000,000$40,000,000$45,000,000$50,000,000$60,000,000$70,000,000$80,000,000$90,000,000$100,000,000
Max
Max$250$500$750$1,000$1,250$1,500$1,750$2,000$2,250$2,500$2,750$3,000$3,250$3,500$3,750$4,000$4,250$4,500$4,750$5,000$5,500$6,000$6,500$7,000$7,500$8,000$8,500$9,000$9,500$10,000$10,500$11,000$11,500$12,000$12,500$13,000$13,500$14,000$14,500$15,000$16,000$18,000$20,000$25,000$30,000$35,000$40,000$45,000$50,000$100,000$125,000$150,000$175,000$200,000$225,000$250,000$275,000$300,000$325,000$350,000$375,000$400,000$425,000$450,000$475,000$500,000$525,000$550,000$575,000$600,000$625,000$650,000$675,000$700,000$725,000$750,000$775,000$800,000$825,000$850,000$875,000$900,000$925,000$950,000$975,000$1,000,000$1,100,000$1,200,000$1,300,000$1,400,000$1,500,000$1,600,000$1,700,000$1,800,000$1,900,000$2,000,000$2,250,000$2,500,000$2,750,000$3,000,000$3,250,000$3,500,000$3,750,000$4,000,000$4,250,000$4,500,000$4,750,000$5,000,000$7,500,000$10,000,000$12,500,000$15,000,000$20,000,000$25,000,000$30,000,000$35,000,000$40,000,000$45,000,000$50,000,000$60,000,000$70,000,000$80,000,000$90,000,000$100,000,000
Min
Min123456789101112131415
Max
Max123456789101112131415
More Filters0Less Filters
More Filters0Less Filters
Save Search
Min
Min1002003004005006007008009001,0001,1001,2001,3001,4001,5001,6001,7001,8001,9002,0002,1002,2002,3002,4002,5002,6002,7002,8002,9003,0003,2503,5003,7504,0004,2504,5004,7505,0005,5006,0006,5007,0007,5008,0008,5009,0009,50010,000
Max
Max1002003004005006007008009001,0001,1001,2001,3001,4001,5001,6001,7001,8001,9002,0002,1002,2002,3002,4002,5002,6002,7002,8002,9003,0003,2503,5003,7504,0004,2504,5004,7505,0005,5006,0006,5007,0007,5008,0008,5009,0009,50010,000
Min
Min1234568101214161820253035404550556065707580859095100
Max
Max1234568101214161820253035404550556065707580859095100
Min
Min202620252024202320222021202020192018201720162015201420132012201120102009200820072006200520042003200220012000199919981997199619951994199319921991199019891988198719861985198419831982198119801979197819771976197519741973197219711970196919681967196619651964196319621961196019591958195719561955195419531952195119501949194819471946194519441943194219411940193919381937193619351934193319321931193019291928192719261925192419231922192119201919191819171916191519141913191219111910190919081907190619051904190319021901190018991898189718961895189418931892189118901889188818871886188518841883188218811880187918781877187618751874187318721871187018691868186718661865186418631862186118601859185818571856185518541853185218511850184918481847184618451844184318421841184018391838183718361835183418331832183118301829182818271826182518241823182218211820181918181817181618151814181318121811181018091808180718061805180418031802180118001799179817971796179517941793179217911790178917881787178617851784178317821781178017791778177717761775177417731772177117701769176817671766176517641763176217611760175917581757175617551754175317521751175017491748174717461745174417431742174117401739173817371736173517341733173217311730172917281727172617251724172317221721172017191718171717161715171417131712171117101709170817071706170517041703170217011700169916981697169616951694169316921691169016891688168716861685168416831682168116801679167816771676167516741673167216711670166916681667166616651664166316621661166016591658165716561655165416531652165116501649164816471646164516441643164216411640163916381637163616351634163316321631163016291628162716261625162416231622162116201619161816171616161516141613161216111610
Max
Max202620252024202320222021202020192018201720162015201420132012201120102009200820072006200520042003200220012000199919981997199619951994199319921991199019891988198719861985198419831982198119801979197819771976197519741973197219711970196919681967196619651964196319621961196019591958195719561955195419531952195119501949194819471946194519441943194219411940193919381937193619351934193319321931193019291928192719261925192419231922192119201919191819171916191519141913191219111910190919081907190619051904190319021901190018991898189718961895189418931892189118901889188818871886188518841883188218811880187918781877187618751874187318721871187018691868186718661865186418631862186118601859185818571856185518541853185218511850184918481847184618451844184318421841184018391838183718361835183418331832183118301829182818271826182518241823182218211820181918181817181618151814181318121811181018091808180718061805180418031802180118001799179817971796179517941793179217911790178917881787178617851784178317821781178017791778177717761775177417731772177117701769176817671766176517641763176217611760175917581757175617551754175317521751175017491748174717461745174417431742174117401739173817371736173517341733173217311730172917281727172617251724172317221721172017191718171717161715171417131712171117101709170817071706170517041703170217011700169916981697169616951694169316921691169016891688168716861685168416831682168116801679167816771676167516741673167216711670166916681667166616651664166316621661166016591658165716561655165416531652165116501649164816471646164516441643164216411640163916381637163616351634163316321631163016291628162716261625162416231622162116201619161816171616161516141613161216111610
Min
Min123456789101112131415
Max
Max123456789101112131415
Any
AnyCommercial Improved PropCommercial Land/UnimprvdCommercial LeaseCommercialLeaseCommercial SaleCommercialSaleCondominium/TownhomeFarmLandMulti-Family (2-8 Units)ResidentialResidential IncomeResidential LeaseResidentialLease
Any
Loading in progress…
No results found
Please start typing…
Anyandersonangelinaaransasatascosaaustinbanderabastropbeebellbexarblancobosquebowiebrazoriabrazosbrewsterbrooksbrownburlesonburnetcaldwellcalhouncallahancameroncasschamberscherokeeclaycokecolemancollincoloradocomalcomanchecoryellcrockettcrosbydallasdentonde wittdewittdimmitduvalectoredwardsellisel pasoerathfallsfayettefort bendfreestonefriogalvestongillespiegoliadgonzalesgregggrimesguadalupehallhamiltonharrishayeshayshendersonhidalgohillhoodhopkinshoustonhowardhudspethhuntjackjacksonjasperjeffjeffersonjim hoggjim wellskarneskaufmankendallkenedykerrkimballkimblekinneykleberglampasasla sallelavacaleeleonlibertylimestonelive oakllanolubbockmadisonmarionmasonmason comatagordamaverickmccullochmclennanmcmullenmedinamenardmidlandmilammillsmitchellmontaguemontgomerymoorenacogdochesnavarronewtonnuecesorangeotherout of stateparkerpecospolkpresidiorainsrealred riverreevesrefugiorobertsonrockwallrunnelsrusksan jacintosan patriciosan sabaschleichersmithstarrstephensstonewallsuttontarranttaylorterrelltom greentravistrinityuvaldeval verdevan zandtvictoriawalkerwallerwashingtonwebbwhartonwheelerwichitawillacywilliamsonwilsonwiseyoakumyoungzapatazavala
Any
Loading in progress…
No results found
Please start typing…
Anyabbottabileneadamsadamsvilleadkinsagua dulcealamoalamo heightsalicealleytonalpinealtoaltonangletonaquillaaransas passarlingtonashertonaspermontatascosaathensaubreyaustinaustwellavingeraxtellbalch springsbalcones heightsbanderabangsbarksdalebartlettbastropbatemanbatesvillebay citybaytownbeasleybeaumontbediasbee cavebeevillebellevuebellvillebelmontbeltonben arnoldbendberclairbergheimbernardobertrambexar cobigfootbig springbig wellsbishopblancoblessingbloomingtonblufftonboerneboydbrackettvillebradybrazoriabreckenridgebremondbrenhambriarcliffbriggsbrookshirebrowndellbrownsvillebrownwoodbruceville-eddybruceville eddybryanbuchanan dambuckholtsbudabullardbulverdeburlingtonburnetburtoncaldwellcalvertcameroncampbelltoncamp verdecamp woodcanyoncanyon lakecarltoncarminecarrizo springscastellcastle hillscastrovillecedar creekcedar parkcelestecentercenter pointcenterpointcentervillechandlerchannelviewchappell hillcharlottechiltonchina grovechina springchristinecibolocisterncity by the seaclarksvilleclevelandcliftoncoldspringcolemancollege stationcolorado citycolumbuscomanchecomfortcommercecomstockconcanconroeconversecopperas covecorpus christicorsicanacostcottonwood shorescotullacouplandcrawfordcreedmoorcrockettcrosbycross plainscrowleycrystal beachcrystal citycuerocut and shootcypresscypress milldaledallasdawsondaytondeer parkde leondell citydel riodel valledentondevinedhanisdickinsondilleydime boxdossdouglassvilledriftwooddripping springsdrydendumaseagle lakeeagle passearlyeddyedinburgednaegyptel campoeldoradoelginel indioellingerelmendorfel pasoel toroencinalencinoeurekaevantfairfieldfair oaks ranchfalfurriasfalls cityfanninfayettevillefentressfischerfischer (comal)flatoniaflorencefloresvilleforestburgforest hillfortdavisfort mckavettfort stocktonfort worthfowlertonfrancitasfranklinfredericksburgfredoniafreeportfreerfreyburgfulshearfultongalvestonganadogarden ridgegarfieldgarlandgatesvillegausegeorgetowngeorge westgeronimogholsongiddingsgillettgirvingoldthwaitegoliadgonzalesgrahamgranburygrand prairiegrangergranite shoalsgrey forestgroesbeckgrueneguadalupegustinehallettsvillehamiltonhardinharker heightsharlingenharperharwoodhayshearnehebbronvilleheidenheimerheloteshempsteadhendersonhewitthicohidalgohighland havenhighlandshill country villagehillsborohilltop lakeshitchcockhobsonhockleyholiday lakeshollandhollywood parkhondohorseshoe bayhoustonhubbardhuffmanhumblehunthuntingtonhuntsvillehuttohyeindian gapinezinglesideingleside on the bayingramiolairedellirvingitascajacksborojamaica beachjarrelljasperjewettjohnson cityjonesborojonestownjourdantonjunctionjustinkarneskarnes citykatykempkempnerkendaliakenedykerenskerrvillekilgorekilleenkingsburykingslandkingsvillekirbyknippakossekylelacostelago vistala grangelagrangelajitasla joyalake citylakehillslake jacksonlakewayla marquelampasasla pryorlaredolaruela verniala wardleague cityleakeyleanderledbetterleesvillelemingleon valleylexingtonlibertyliberty hilllincolnlindalelittle elmlittle river academylive oaklivingstonllanolockhartlolitalometalondonlongviewlorenalottlouiseloveladylubbocklufkinlulinglyfordlytlemabankmadisonvillemagnoliamanchacamanormarble fallsmarfamarionmarlinmarquezmartmartindalemasonmatagordamathismaudmaxwellmcallenmccoymcdademcgregormckinneymcqueeneymeadowlakesmedinamenardmercedesmeridianmesquitemexiameyersvillemicomidfieldmidlandmidlothianmilanomilfordmineralmissionmontgomerymoodymooremorganmorgans point resortmorris ranchmoultonmountain citymountain homemount calmmuldoonmullinmurchisonmustang ridgenacogdochesnatalianavasotaneedvillenew braunfelsnew caneynewtonnew ulmniederwaldnixonnoconanolanvillenordheimnormannanorth zulchnurseryoakallaoakvilleodemodessaoglesbyolmos parkonalaskaorangeorange groveorchardotherout of stateozonapaigepalaciospalestinepandalepawneepearlandpearsallpecospenelopepettuspflugervillepharrpipe creekplacedoplantersvillepleasantonplumpointpoint comfortpoint venturepontotocport altoport aransasport bolivarport isabelportlandport lavacaport mansfieldport o'connorport o connorpoteetpothprairie leapremontpresidioprincetonpurdonpurmelapursleyquemadorallsraymondvillereaganreagan wellsrealitosred rockrefugiorichland springsrichmondrio friorio medinarivierarobert leerobinsonrobstownrochellerockdalerock islandrockportrockspringsrockwallrogersrollingwoodromarooseveltrosankyrosebudrosenbergrosharonround mountainround rockround toprungeruskrutersvillesabinalsaladosan angelosan antoniosan benitosandersonsandiasan diegosan isidrosan juansan marcossan sabasanta clarasanta fesargentschertzschulenburgseadriftsealyseguinselmashallowatershamrockshavano parksheridanshinersierra blancasintonsisterdaleskidmoresmileysmithvillesnooksomersetsomervillesonorasouthlakesouth padre islandspicewoodspoffordspringspring branchspringtownst.hedwigstagecoachstaplesstephenvillest hedwigsthedwigstockdalestonewallstreetmansunrise beachsunrise beach villagesunset valleysurfside beachsutherland springstafttarpleytaylortelfernertempletennessee colonyterrell hillstexas citythe hillsthomastonthorndalethorntonthrallthree riverstildentivolitomballtowtrinitytroytuletaturkeytyleruhlanduncertainuniversal cityutopiauvaldevalley millsvalley springvanderbiltvanderpoolvictoriavolentevon ormywacowaelderwalburgwallerwalliswallisvillewalnut springswaringwashingtonwatsonwaxahachiewebbervilleweimarweirwelfareweslacowestwest columbiawesthoffwest lake hillswest pointwhartonwhite oakwhite settlementwhitneywhitsettwichita fallswilliswillow citywimberleywindcrestwinnsborowoodsborowoodwaywrightsboroyanceyyoakumyork townyorktownzapatazephyr
Any
Anycadcilnhortntx
Any
Loading in progress…
No results found
Please start typing…
Any"out"/blanco"out/aransas""out/burnet.""out/frio""out/guadalupe""out/harris""out/karnes"(2500) luling central southwest - neighborhood(2530) luling riverpark dr - neighborhood(2825) schicke area wf/wv area(4120) rural fm 2001-schulke rd area(4140)rural fm 20 w-callihan rd-westwood rd area(4150) rural plant rd-washburn rd-fm 2984 area(4220) rural mcmahan area(24080) southside rural acreage (so)(95230) loma area 2 (ed)(98002) dellview (ne/sa)(99105) hidden meadows(a0405) a0405 john hamilton(a de la vina a-71) 03 mh 16 x 76(brenham6) brenham 6(bridgt) yr1 bridlegate(c458-lp337) north loop 337(cdcs) cedar crest(chr/m4) chr/m4(cla40) common land area - 40(cla45) common land area - 45(cpl/f3e) cpl/f3e(crd res 4) city of rockdale res 4(e res 1) eagle lake residential 1(f600) fbg 290 east & se(flrural/rf) flsv rural rf ma(flsvrural) floresville rural imps(hamil) hamilton study(har)(kvfd) kempner vfd parcels(lamriv) lampasas river(nbhd0512) elgin rural 002(nbhd1907) smithville rural 003(nccisd) nueces canyon cisd(p1100) poth abstracts(p2150) green & houston sub(r res 1) rural res 1(r res 2) rural res 2(rural2) rural ac. area 2(rural_g06) rural nbhd geo region(rural_g24) rural nbhd geo region(rural_g28) rural nbhd geo region(rural_g29) rural nbhd geo region(sdein) devine isd in town(see legal desc.)(sho) hondo isd out of town(shoin) hondo isd in town(sisdrural) stockdale rural(slg_imps) slg rural imps.(sly) lytle isd out of town(sly/t5s) sly/t5s(smv) medina valley isd out of town(smvin) medina valley isd in town(snain) natalia isd in town(spl/-m6) spl/-m6(sw shores) stillwater shores(the reserve at sonoma verde)(wd3) yr4 whartons dock(wf) water frontage(wf west) yr4 waterfront west(whdi) yr4 whartons dock--na-..10 acr, s del valle, abs 24.88 acre out of the theo bissell league/000000000101 nb lake1a1b1c-steiner ranch blvd1n02 nb lake2n3 burgess a-2 tr 20e3-g ranch addition3abs3e04 flats condo amd4 points landing4 springs ranch4abs4s ranch 6a4s ranch phase-i4s ranch un-4a4s ranch un 9a4s ranch unit-7c4th&05 nb lake05cen5e5th a condo5th and west building6 creek ph 1 sec 126 creeks6 creeks at waterridge6 creeks at waterridge: 55ft. lots6 creeks ph 1 sec 16 creeks ph 1 sec 26 creeks ph 1 sec 36 creeks ph 1 sec 4a6 creeks ph 1 sec 4b6 creeks ph 1 sec 5a6 creeks ph 1 sec 8a6 creeks ph 1 sec 8b6 creeks ph 1 sec 96 creeks ph 1 sec 13b6 creeks sec 107 creeks7 creeks ranch07 nb lake7 oas ubdivision un 2 ncb 17828 acres split out of original 158e08sc18th street dev8w10 industrial park10.29 acres10n10s10th street dev12 acre add12 acre addition12/rock prairie sub ph 213 blk: addn: university place14 belmont park14ten condos15.9+/- acres16 new braunfels17.7+/- acres21-summit/v. merrill/134122 alexander a22 central25.524 acres - apache springs26th/ zarzamora26th/zarzamora26th/zarzmora27 wm hill30th street condominiums33.62 acres35 south ranches sec 235.389 acres41 ranch41 waller lofts0004244 east44 east ave44 east ave. condominiums44 east ave condo44 east ave condominium44 east ave condominiums44 east ave condos44 east avenue condominiums44 east condo44 east condos48 east condominiums48 east condos51 east51 east condominiums52 mueller condominiums58eas68.85 acres70 rainey70 rainey condominiums70 rainey residences75 bbb & c rr acres100 el prado100 west 55 1/2 street condomi01010102010301040105105 henry bymer116 enterprises add135 fm 468 big wells, tx 78830160.45 acres173 country meadows185 la quinta condo ah189+/- acres190 bagdad condos0200200 acres252 prosper hope0270.59s48 - lg valley mills272 ac fitzhugh0300301 denali pass condos304 blackson avenue condominiums306 east 34th street condo307 east 35th street condomini360 condominiums380 martin ave0400400 & 402 west 51st street con400 e 30th street condo408 west odell street site condominiums464 ranch04960500500 & 502 west 51st street con500 southland drive504 blackson condos510 blackson condiminiums571/184-6 (cb 4334b (champions park ut-5 & 6))0600600 guadalupe master condo604 the amd607 montopolis613 west annie street condomin0700701 49th street estates condom705 e 49th street condo708 west milton condo709 w st elmo site condos710 condominiums720 pedernales condo755 easton drive, san marcos, tx 786660800805 cumberland condo809 mariposa condo0900900 karen ave condos900 s 1st st condos901 bouldin condo908 nueces condos909 west johanna condo910 tillery condos913 stobaugh street condos969 sub1000 blk of east 11th street1000 oaks rcqt club ne1000 west oltorf condo1007 east 15th condos1106 w 22nd street condo1108 nueces st, austin, tx 787011124 linden street condos1141 berger condos1168 & one-half ridgeway drive1182 oak grove ave condos1191 ridge dr1191 ridge drive1200 greenwood ave condos1201 - abernathy isd01300 rachal addn1301 webberville road condos1303 lockhart res -neches-pancho-torres1304 palo duro condos1305 lofts a condo amd1306 west1310 cedar ave condos1310 choquette drive condos1313 condos1402 braes rdg condos1402 singleton condo1406 ulit condos1510 west 6th street condo1510d291 - town of liberty hill - lt 19501511 camp craft road condos1523 piedmont condos1603 willow condos1604/inner loop development remains1605 hether condos1608 ulit ave condos1612 shenandoah condominiums1615 east 7th condos1700 scenic drive condos1704 e 13th street site condos1709 perez condos1736 bunche condominiums1796 ranches1809 chestnut condominiums1904 e 16th st condominiums1905 pennsylvania ave condominiums1912 lightsey condominiums2000 windy terrace industrial condominium2000 windy terrace industrial condominiums2002 e 13 street condo2003 rountree site condominiums2009 canterbury street site co2010 goodrich condo ame2010 goodrich condominiums2020 congress condo2100 prather lane condos2101 airole way condos2101 montopolis residential co2103-1 frio eastside living co2104 angle estates2104 east 2nd street condominiums2202 willow condo2206-2210 south congress condo2216 lindell ave condos2220 leon condo amd2220 yellow jacket condominiums2300 hancock drive condo2301 mission hill drive condos2308 maxwell condominiums unt 2 plus 40.00 % int i2404 east 13th condomiiniums2411 euclid ave condo2416 e 10th st. condominiums2421 s 5th street sub2430 acres2512 wheless condos2605 south 2nd street condominiums2612 & 2614 willow condo2702 crest ave condo2711 stacy lane condominiums2714 stacy condos2802 warren street condo2805 sol wilson condo2905 east 5th condos2912 govalle site condos2919 e 13th condos3114 soco3201 5th street condo3214 clawson road condo03230-003309 robinson condo3409 neal condominiums3417 willowrun drive condominiums3505 villa court condo3604 marcae condos3607 grant st condominiums4001condos4101 menchaca4120 valley view condo4140(rural fm 20w-callihan rd-westwood rd area4220 rural mcmahan area4400 w hwy 290 sub4506 russell condominiums4606 gonzales condos4701 sylvandale drive site con4706 sylvandale site condos4808 richmond ave condominiums5007 lott ave condos5114 ave g condo5305-09 guadalupe condo5369a - hines ranches unit 25373 williams drive office condos5406 downs drive condos bldg 15517 ave g condo5555 fredricksburg5601 jackie robinson site street condominiums5604 samuel huston avenue5704 gloucester condos5902 mountainclimb condo6101 adalee ave condo6517 teramo ter6713 west gate boulevard condo6807 woodhue drive condos7206 carver site condos7300 south congress7300 south congress condos7525 delafield condos7601 bethune condos7601 carver ave site condos7607 providence site condos7701 wurzbach condo ns8888 tallwood condo amd9622 sugar hill drive condos9960mr2pd - palm valley professional & medical sui9960mr2pd-palm valley professional & medical suite9999 - other9999-other10506 little pebble drive condo11315 poquito condo ame13239 horseshoe bay14870 bois d'arc sub18901 hog eye rd000004048542100 - meadows052550-000555100 - sfa #10: a194aa & b subdivisiona & d acresa)173 thomas h w forsith survey, acres 4.00a- 2 sur- 1 j m veramendi - comala- 4 sur-193 j arochaa-9 j burnham 14.853 aca-14 n de la cerda p 192a-84a-168 sur-138 a foerstera-343 jett surveya-439 sur-760 e nortona-452 sur- 4 m w pottera-537 sur-434 j startza-620 sur-122 w s turnera-620 sur-122 w s turnera-650 sur - 720 j vogela00003a00009a0001a0001 phillip j allena0005a0005 aguilera, jose ygnacio block 1612 tract 1 ,a0008 - william h haggard surveya00084a00089a001a001 austina0010 - acosta, juan josea0010 f flores sur, tract 63e, acres 29.a0012 bc a menchacaa00123407400a0014a0014 john stewart survey, acres 1.9772a0014bc m moreno, 377-1, acres 1.0a001600a0017-2 juan m veramendi survey #2a002a0020 dickinson la0024a00277 f de la garza sv-46a00307 a y gates sv-1220 1/2a00309 j b goettlemann sv-512a00405a0061bc e brewer, acres 10.264a0062a0063a0070 chambers, t.j.a00734a00758 j ryan sv-309a0084 - elijah clark surveya009a009 george, james, acres .25a009 george, james, acres 70.125 & a020 neill, joha010 gillan, michael, acres 1.696a0101 a0101 - john cassady surveya011a0129 - phillip h commans surva0130 - hinton curtis surva0130 davilla, miguel,13.827 acresa01334a0151a016a0160a0166 - jesse b eaves surveya0167 - otis g eels surveya0168a017a017 lockhart, byrda0173 - thomas h w forsith surveya0174a0187 j. casiano survey 904a0188a019 - morrison, stephen b.a0201bc w h colea021 - pettus, williama0210 - friar, daniel b.a0215a0216-jflores #10a022a022 wallace, j. y., tract 022e, acres 9.424a0220a0220 - a0220 - z hinton surveya0220 - z hinton surva0227 james w hall surveya0228a0233;a0037a024 andrews, j. w.a0250a0256 - john ingram surveya0277-a0277-john keeley surveya0280a0291 - james lynn surveya030g p varela-groesbecka0300a0300 lewis, w.w.a0304 rice jas o tract 5a0309 abstract 0309 survey 73 a-309 s-73 18.56a0329bc s fraziera0332 - a0332 - john mcshane surveya0337a0347 - conrad overland surv #46a035a0355 thomas f. gravisa0366a0379bc j hughsa038a0387a040a0415 philip a smith surveya0430a0430 de pena, j.a.,10.02 acresa0433a0452a0467 - william ward surveya0509a0509 - l s yeates surva0510a0530a0535a0554bc f madregala05740a0575a0606 - a0606 - joseph c stevenson surveya0606bc l moorea061a063a063 connell, sampsona0632 mina wilson survey, 20.3 acresa064a066a0663a068a068 crenshaw, corneliusa069a0720a074a0740a0740 arnetta079 cooka081a083a0840 burnhill, john na0844a087a089a097a0976 - allison williamsa0995a4 - austin, stephen f.a11a11 - bastrop town tracta11 bastrop town tracta20 - christian, thomasa23a28 james doyle acresa29a34a42a42 (nbhd0218) bastrop rural 006a53 navarro, jose a., tract 4, acres 10.069a56 rousseau, mozea, acres 7.597a74 andrews micaha85 - beasley, s. s.a86 nbhd0511) elgin rural 001a91a102a107a107 folley, john h., acres 13.992a115a115-guadalupe collegea116a123 hines, elberta130a140, clelland, john j.a156a157a171 - levy, albert m.a172a174a178a189a190 - holderman, jessea192a193a194a196 morton, john v., acres 7.109a211a218a222a222 morrow, t.a222- morrow, t.a230a235 person, edmund h., acres 5.0, lot 4 spring cra238 - mckeon, timothya246 - montgomery, james s.a250a258a267a267 reid, s. h.a270 - ortiz, josea271a287 - stiffler j lg & labora289a289 tylera308a312a335a341a343 - whittington, t. m.a346 j o moore, acres 31.5a347a347-wilkerson f.a361 h.e. & w.t.r.r.co., tract 87, acres 1.00a404a 522 standish & a 372 kelleya1046bc w a riggsa1053a1114a1420 dobbins, sterrett, 51.193 acresa1868 - (smfa) south of mf acreagea1870 holtzclaw, b.w.,tract 16,10.339 acresa2230a3250 st. clairea3280 swoap, benjamin,35.018 acresa3980a10127 - survey 175 w l cazneaua10262 - survey 709 c heiligmanna10349 - survey 865 j v masseya10433-survey 6 john sweeneya10568 - survey 23 gb&cng rra11001a 326200 aa 326200 a-262aa lewis a-384a arochaaaron acresaaron f. boycea b & moultonab 665abbateabbey roadabbey subdivisionabbottabbott estatesabbott placeabbott rd scabbott runabigail fokesabileneabooha toklo addabrantesabrego lakeabsabs, a34 graham, andrewabs 13 sur 1 grittenabs 20 sur 1 slaughter s f acr 2.713abs 27 sur 2 wilson wabs 27 sur 2 wilson w acr 1.32abs 34abs 118 sur 58 baxter w p acr 5.30abs 206 l gibbs surveyabs 207 sur 740 cox b f acr 315.3630 [1-d-1]abs 249 sur 105 d & w r r coabs 415 p a smith surveyabs 463 sur 24 j pabs 463 sur24 kempe jp acres 48.723(1-d-1).abs 523 sur 4 montgomery j s acrabs 546 sur 40 manorabs 808 sur 39 woffordabs 2200 sur 39 scott s t acr 5.425abs 2345 sur 530 moore w p acr .594abs: 20 sur: a m esnaurizarabs: 20 sur: a m esnaurizar 13.7016 ac.abs a-multiple multiple abstabs a00001 d.f. owen, tract 5, 5.13 acresabs a00274 d forest sw-1047abs a0318 henry m. fockabs a0535 survey 7 s. stivers,acres 2.796abs a073 muldoon m #5 lgabs a090 savageabs a34 graham, andrewabs a118 zumwalt a jr, 24 acresabs a140 berry d,tract 18,10.0 acres,hse, stgabs a 182abs a182 garrett, john (v l evans)abs a225 leverence, l.,tract 3, 6.52 acresabs a240 matthewsabs a257 powell a lg,abs a french samuel, 3.45 acresabst 17-1 1.863 ac 51-205 j m veramend geo#9020088abst 28abst 125 sur 503 beaty, seale & forwoodabst 154abst 231`abst 600 e nolandabst 676abstract 0028, jas hall surveyabstract 18abstract 320abstract 459abstract 4800 francisco ruizabstracts in haysabstracts in hays isd-2absab williams surv abs 353a castleman lga cervantesackerman gardensackerman gardens unit-2a conners addnacorn grove estatesacracr: 148 abst: 0596 surv: j j stubblefieldacreacreage estates on pauline laneacres: 221.876 james l jobe abst-395adamsadams beaty & moulton survadams david gadams hilladamsvilleadam zumwalt surv a-118addendumaddie condoaddisonaddison littonaddison sec 1 subaddison sec 2 subaddison sec 3addison sec 4addison sec 4 subaddison sec 5addn: paul jubelaadeltonadelynn at muellera dickson sur abs #266adkinsadkins areaadkins area ecadmiral heightsadolphina d ryana e gossettaerovistaa flores sura f weatherford #1a f weatherford #2agagaveagave, sendero hillsagave at gruene rapidsagave lofts ii condosagave traceagave | meadows at trinity crossinga g coers iia g coers ii lot 1 duplex geo#33092074aggie & woodrow condoagua dulcea h barnesa h bean surv #77 abs # 137a hopea h pierce koch subainsworthairline terrace iiiairport annexairport citya j grebey #2ake, wm. surakersakers additionakers devakoya condo amdakumalalameda gardens edalamoalamo acresalamo beachalamo estatesalamo farmsteadsalamo farmsteads nsalamo heightsalamo heights 1 port lavacaalamo heights 2 port lavacaalamo hillsalamo ranchalamo ranch ut-7alamo ranch ut-12a & 12balamo spgsalamo springsalamo springs ranchalamo st estatesalanna heightsalazan apache courtsalbert 303albert pace subdaldea del sol condoaldea del sol condominiumsalderaldridge placealegria condo amd 1902alexanderalexander aalexander acresalexander hannaalexanders addalexander unrecalexandria ph 2balford ranch estates unrecordedalicantealicante condosalicante condo twnhms amdaliceall 53 nordheimallandaleallandale condosallandale estates sec 01allandale estates sec 04allandale northallandale north sec 01allandale north sec 03allandale north sec 06allandale north sec 3allandale oaksallandale park sec 02allandale park sec 04allandale park sec 05allandale park sec 06allandale park sec 09allandale place sec 01allandale sec 03allandale terrace sec 02allandale terrace sec 02 ph 04allandale terrace sec 02 ph 05allandale terrace sec 03allandale theallandale west sec 01allandale west sec 04allandale west sec 05allegro north condominiumsallen & flewellens subdivisioallen, james wallen, williamallen/decrow/tllley/greenallen carterallendale condo amdallendale ph oneallen estatesallen j ballen park ph 02allens bendallen talbott surv abs #336allen terrace suballeytonallison-richey land co suballison laura l resuballison williamsalmar heights un 2 ncb 13073aloe west subalpha addalpinealpine green condominiumsalpine slopesalsatian heightsalsatian oaksaltairaltamiraalta mira sec 1 at circle c raalta vistaalta vista ialta vista iialta vista ph iiialtenhofaltoalto lagoalto lago 1altonalto vista blk 11 lots 11 & 12 50x135.6altwein mobile home estatesaltwein tractsalum creek estatealura pointe condoalwin c bechtoldam10dlxi - mh - sle/slh/sbuam30ddxi-mh-sfl/sjaam40sdxi - mh eastamanda parkamanda park phase 2amarraamarra cottages condosamarra drive ph 02amarra drive ph 03amasa turner surv #1 abs 461amata terra addamber creekamber oaksamber oaks condosamber oaks ranchamberwoodamberwood ph oneamberwood ph threeambick nextgenamended plat/stonewall ranch samending plat/oakmontamending sun city nbrhd samerican townsite co 1849american townsite co 1857a m esnaurizara m esnaurizar 11 league grantam esnaurizar 11 league grantamhurstamifast indust parkamity estatesamity estates phammann oaksammann oaks 1ammann ranch estatesammannsvilleammaron hillsamorosaamos alexander surv #22a m ramsayamry terraceanaqua springs ranchanastasha carr surv abs #122anca additionancient oaksancient oaks sec 1andalusia condosandalusia unplatted suband betty banksanderleandersonanderson addanderson add 1anderson aliceanderson millanderson mill/deerbrook villageanderson mill center ph 03anderson mill e estatesanderson mill estatesanderson mill lake sitesanderson mill villageanderson mill village 12anderson mill village southanderson mill west 4anderson mill west sec 01anderson mill west sec 02anderson mill west sec 03anderson mill west sec 05anderson mill west sec 06anderson mill west sec 16anderson mill west sec 17anderson mill west sec 21anderson tanderson tractandice viewandres m garza partitionandrew grahamandrews, micahandrews, richardandrews acresandrew winters league & laborandrusandtree add sec oneangel bayangel bay poaangel fireangel hill subangelina & 12th condominiumsangelina+12th condominiumsangell c langell c l subdangels acresangels ridgeanglers village pocangletonanglina n greenangus ranchangus valley 02angus valley 11angus valley annex sec 02anitas acres 2annabelle ranchanna harrisonannie blumannie cunninghamsanointed acresanother worlda n proctorantcantelopeantelope runanthemanthem cottages condoanthem ph 1-aanthem ph 1-banthem ph 2anthem ph 3anthem ph 4aanthony g davyanthony g davy surv #38 abs #anthony w bantonio & maria esnanrizar surveyantonio highlandsantonio maria esnaurizar sec 1antonio navarro 7 league grantantonio navarro surv a-18anyons at amhurstao220 hinton surveyapacheapache creekapache point revapache shoreapache shoresapache shores 01 instlapache shores sec 02apache shores sec 03 amdapache shores sec 04apache shores sec 05apache shores sec 06apache shores sec 07apache shores sec 5apache tracea perfect worldappaloosa acresappaloosa runapple ciderapple creekapplehead islandapplehead westapple spgs subapple springsapplewhite estatesapplewhite meadowsapplewoodapplewood unit 1aqua monteaqua verdeaquila acresaquillaaransas passaransas pass-ap trianglearansas pass-burton & danfortharansas pass-harbor heights paransas pass-pelican covearb bartlettarbolagoarbolago; lakewayarbor at blossom hills gdn hmsarbor at great hills the amdarbor at sonoma rancharbor centerarbor creekarboretum park residential sub condoarbor hillsarbor of rivermistarbor ridgearbor ridge condo amdarborsarbors/lakeline condosarbors/lakeline condos bldg 38arbors/lakeline condos bldg 40arbors/lakeline condos bldg 54arbors at fair oaksarbors at lakelinearbors at lakeline condoarbors at riverside condo thearbors at turle rockarbors at turtle rockarborstonearbor village condoarcadia condo amdarcadia rdgarcadia rdg ph 3 un 10a cb 435arcadia ridgearcadia ridge phase 1arcadia ridge phase 1 - bexar countyarched oakarcher james barcher oaksarch ray condominiumsarch ray condo rv & cabin communityarch ray condosarch ray on the riverarch ray o the riverarden springdalearies placearista san gabrielarlingtonarmadillo estatesarmadillo estsarmadillo pksarmstrong estatesarmy terrace additioarnold kooparocha, j.n.ar pass-fricksarrowheadarrowhead pointarrowhead point 01arrowhead point subdivisionarrowhead rancharrowhead ranch 50'sarrowhead ranch ph 1arrowhead ranch ph 3arrowhead ranch ph 4arrowhead trailarrowhead trail rancharrowhead trail ranch subarrowood estatesarrowpointarrowwood, milwoodarrowwood sec 02arroya vistaarroyoarroyo doble estates sec 02-aarroyo doble estates sec 02-barroyo doble sec 03arroyo farmsarroyo park sub ph iarroyo rancharroyo ranch ph 2arroyo ranch phase #1arroyo ranch ph iiarroyo ranch ph iiiarroyos at the cibolo canyonsarroyo verdearroyo verde 3arroyo verde sub un 4arroyo verde un 1arroyo vistaarsenalarsenal historic/non historicartesian oaksartesian retreatarthur luckeyartisan park at victoria commonsascensions/lk travis condosascensions on lake travisa scott sv-74ashbrookashby acresashdale gardens condoasher placeashertonasherton original townashford park sec 1ashland pinesashley heightsashley oaksashley placeashten addashton green condoashton parkashton park ut-1ashton woodsashton woods condoashton woods condominiumsaspen park eastaspen park westaspen villageaspermontaston parkaston park subastoria placeastro hillsastro hills 1astro hills 2atascocita ranchesatascosaatascosa estatesatascosa river ranchettesatascosa trailsathensa thompson surv abs 813atkin addat rivery park ph 1at rivery park ph 5at rivery park ph 7attalaubreyauburn hills at woodcrestauburn ridgeaudrie brianna estatesaugust fieldsaugust fields 1august fields ph 2august fields ph 3august fields ph 4augustus passaurvey 180 mi lealaus - parkside on the riveraus - parkside on the river 70'austinaustin's colonyaustin's colony phs 2austin's colony sec 6aaustin, stephen faustin aquaplexaustin city loftsaustin city lofts amdaustin colonyaustin colony ph 05 sec 02austin co one leaguaustin co threeaustin co three leagueaustin county school land 3 leaustin grantaustin heightsaustin heights amdaustin heights condoaustin highlands sec 02austin hills sec 01austin hills sec 05austin hwy heights subneaustin lake estates sec 01austin lake estates sec 02austin lake estates sec 03austin lake hills sec 01austin lake hills sec 02austin lake hills sec 03austin lake hills sec 2austin lake hills sec 3austin modern lofts condosaustin oaks sixty 08austin properaustin rivertree condoaustins colonyaustins colony ph 03austins colony ph 04austins colony ph 05 sec 01austins colony ph 05 sec 02austins colony phs 2austins colony sec 6aaustins colony sec 6baustins colony sec 7aaustins colony sec 9austins colony sec 12austins creekaustin skylineaustin skyline sec 01austin skyline sec 02austin skyline sec 04austin skyline subaustin stephen faustin woods amdaustonian condo communityaustwellautry pondautumn ridgeautumn runautumn run jdautumn wood nsavalonavalon (cherrywood)avalon ph 01avalon ph 02avalon ph 03avalon ph 1avalon ph 5aavalon ph 5cavalon ph 6bavalon ph 6cavalon ph 8aavalon ph 9aavalon ph 9bavalon ph 9cavalon ph 10avalon ph 11aavalon ph 12aavalon ph 14avalon ph 15bavalon place iiavalon place iiiavalon ranchavanaavana @ circle cavana ph 1 sec 3avana ph 2 sec 1avana ph one sec fiveavana ph one sec sixavana ph two sec threeavant ranchavenel at hyde park condoavenidaavenida guadalupeavent r g 03 & 07ac ofland oltavenue f & 54th condominiumsavenue r subaveryavery brookside ph 02avery centreavery centre east ph 1 sec 3avery centre east ph 1 secs 4avery centre east ph i sec 2avery commonsavery estatesavery glenavery morrison subavery parkavery park 13avery ranchavery ranch - ingleside condoavery ranch comm southwest 02avery ranch east ph 01avery ranch east ph 02 sec 01avery ranch east ph 02 sec 03avery ranch east ph 1avery ranch far westavery ranch far westn ph 3 secavery ranch far west ph 01 sec 01avery ranch far west ph 01 sec 02avery ranch far west ph 01 sec 03avery ranch far west ph 01 sec 04avery ranch far west ph 01 sec 05avery ranch far west ph 01 sec 06avery ranch far west ph 02 sec 01avery ranch far west ph 02 sec 02avery ranch far west ph 02 sec 04avery ranch far west ph 03avery ranch far west ph 1 sec 4avery ranch far west ph 3 secavery ranch far west ph 3 sec 3avery ranch far west ph sec 01avery ranch far west ph sec 03avery ranch far west sec 6avery ranch garden homes pudavery ranch glenfieldavery ranch inglesideavery ranch north sec 01 pud amdavery ranch north sec 02 pud amdavery ranch pud garden homesavery ranch south sec 02 ph 06avery ranch west condoavery ranch west ph 01avery ranch west ph 02avery south sec 01 ph 01avery south sec 01 ph 02avery south sec 02 ph 01avery south sec 02 ph 03avery south sec 02 ph 05avery south sec 02 ph 06avery stationavery station sec 1a ph 1avery station sec ii-aavery station section 11-b1aviaraaviara condoaviation heightsavi goodnight townhome condominiumsavi lacrosse condosavingeravion park condominiumsavion park condosavion park condos bldg 3avon heights sec 06avonleaavonlea (las brisas)aw0009 parkeraw0057 - bisset, r. sur.,aw0129 aw0129 - caruthers, j. sur., acres 5.796aw0130 - curry, d. sur.aw0134 cochranaw0235 aw0235 - flores, a. sur., acres 8.799, & awaw0384aw0430 aw0430 - moore, t.a. sur., acres 37.86aw0481 nimmo, s. sur., acres 25.505aw0510 plaster, t.p. sur.aw0528aw0610 thomas, j. sur. 107 acresaw0643 westa webba wellsaxiom eastaxiom east condominiumaxiom east condominiumsaxiom east condosaxion east condosaxtellazalea estatesb & g fulcherb & g fulcher surv a-21b & m addb & r ranchb & r ranchesb + r ranchb2502- somerville placebababcock acresbabcock northbabcock placebabcock place sub un 24 ncb 16babcock ridgebaca add 401backman acresbadgers addbagbybagby- 10 nantucket square condobahia baybailey j surbailey oaks subbailey parkbailey park ph 1bailey park ph 2bailey park ph 3bailey park ph 4bain n m sur 1bakerbaker & campbellbaker addbaker ranchbaker wm j surbalchbalch springsbalcones creekbalcones drive bus centerbalcones flatbalcones flatsbalcones flats-ph ibalcones flats ph ibalcones greene sec 01balcones heightsbalcones hills sec 02balcones park add sec 02balcones park add sec 06balcones park annexbalcones park sec 08balcones place condo sebalcones terracebalcones towers condobalcones villagebalcones village garden homes amdbalcones village sec 03 ph abalcones village sec 06balcones village sec 07balcones village sec 08balcones village sec 09balcones westbalcones woods sec 02balcones woods sec 03abalcones woods sec 03bbalcones woods sec 05baldwins point resubballantyneballantyne sec 2bancroft woodsbanderabandera citybandera crossing resortbandera estatesbandera fallsbandera lakeshorebandera lakeshore beachbandera lakeshore beach 1bandera lakeshore estatesbandera lake shore subdivisionbandera landingbandera landing westbandera passbandera ranchbandera ranch acresbandera rangebandera river ranchbandit condobandit condominiumbangsbangs, j manuelbanister acresbanister acres condo ambanister acres sec 02banister comm areabanister heightsbank of the hills office parkbank of the hills office park condobank of the hills office park condosbar-k ranchesbar-k ranches 02bar-k ranches 03bar-k ranches 04bar-k ranches 06bar-k ranches 07 amdbar-k ranches 08bar-k ranches 08 amdbar-k ranches 09bar-k ranches 10bar-k ranches 11bar-k ranches 12bar-k ranches 13bar-k ranches 14bar-k ranches 16bar-k ranches plat 12bar-k ranches sec 15-abarcelonabarcelona condo ahbarclay estatesbarker, lemanbarker, marthabarker ranch at shady hollowbarker subbar k ranchbar k ranchesbar k ranches plat 11bar k ranches plat 17barksdalebarkuloobarlerbarlow ranch estatesbarnabas perkins surv abs #239barnesbarnes-underwoodbarnes addbarnes solbarracks ii sub ph 108barrington addbarrington oaksbarrington oaks sec 01barrington oaks sec 02barrington oaks sec 03barrington oaks sec 08barrington oaks sec 09barrington oaks sec 5barrington oaks sec 9barrington oaks sec 12bar s ranch 02barstow courtbarstow village amd obartlettbartlett citybartlett city ofbartlett city repbartlett isd abstractsbartlett originalbartletts 2nd addbartletts addbartletts third addbarton, elishabarton, williambarton addn part 3barton bendbarton creekbarton creek lakesidebarton creek lakeside, ranchbarton creek lakeside/the ranchbarton creek lakeside ph 01barton creek lakeside ranch sec 08barton creek lakeside | ranch sec 05barton creek ph 04 sec hbarton creek preserve ph 03barton creek ranchbarton creek sec g ph 02barton creek sec g phs 1barton creek sec j ph 01barton creek sec j ph 02barton creek sec mbarton creek westbarton heightsbarton heights abarton heights b annexbarton hillsbarton hills- horseshoe bend secbarton hills sec 01barton hills sec 02barton hills sec 03abarton hills sec 05barton hills sec 06barton hills sec 07barton hills west sec 01barton hills west sec 01 resubbarton hollowbarton oaksbarton oaks sec 03bartonplace condobartonplace condominiumbarton skyline garden homesbarton spgs parkbarton terrace condobarton terrace sec 01barton terrace sec 03barton terrace sec 04barton view sec 05barton view sec 3 & barton viebarton village sec 01barton village sec 02bar wbar w ranchbar w ranch westbar w ranch west ph 2bar w ranch west ph 3bar w ranch west ph 4bar w ranch west ph 5bar w ranch west ph 7bar w ranch west ph 10 amd finbassbass additionbastropbastrop city 003bastrop county oaksbastrop county westbastrop county west oaksbastrop grovebastrop grove ph 2 sec 4bastrop grove sec 4 ph 1abastrop grv ph 2 sec 4bastrop grv sec 4 ph 2bastrop hills homesitesbastrop rural 004bastrop townbastrop town trbastrop town tr a-11bastrop town tractbastrop west commbastrop west estatesbatele addbatemanbatesvillebattle bend spgs sec 01-abattle bend spgs sec 03battle bend spgs sec 04bauerbauerle ranchbavarian forestbavarian hillsbavarian villagebawcombaxter william cbay addbay citybay city original townsitebay club at falcon pointbay club at falcon point ranchbay countrybayfront at kontiki condominiumsbay harborbay hill deckbaylorbaynebridge condosbayou vistabay point subbay river colony sec 8bayside beachbaystonebaytownbayview acresbayview add port lavacabayview estates sec ii pocbayview estates sec i pocbayview heightsbay view villasbay westbbb & crrb b castleberrybb living sweetwater crossingb c i c div 1beach club condosbeachsidebeachside twnhmsbeacon hillbeaconridge 03beaconridge 04-abeaconridge 04-bbeaconridge vbeaconridge westbeal, johnbeanvillebear creekbear creek country estatesbear creek crossingbear creek estatesbear creek estates ibear creek estates sec twobear creek hillsbear creek oaksbear creek oaks sec 2bear creek parkbear creek ranchbear creek ranch unit 03bear creek ranch unit 04bear spring branchbear spring ranchbear springs ranchbear springs trailsbeasleybeasley, s sbeaty seale & forwoodbeaty seale & forwood surv #43beaty seale & forwood surv #45beaukiss estates iibeaumontbeau sitebeautiful estatebeaver creekbeaver creek land ownersbeaver islandb e beebebys ranch 01 resub of residencebeck additionbecker farmsbecker ranch estatesbeckett meadows sec 01beckett place twnhms a condobeckmanbeck ranchbediasbee cavebee caves vistabee caves vistasbee caves westbeecave woodsbeecave woods sec 01beecave woods sec 02beecave woods sec 02-aabeecave woods sec 03beecave woods sec 03 abeecave woods sec 04beecave woods sec 3beecham gapbee creek estatesbee creek hill estatesbee creek ranchettes sec 01bee creek sec1bee creek subbee hive subbeevillebeeville original townbehrens loftsbehrens ranchbehrens ranch ph b sec 02behrens ranch ph c sec 02behrens ranch ph d sec 02behrens ranch ph d sec 03bbehrens ranch ph d sec 04behrens ranch ph d sec 05behrens ranch ph e sec 01behrens ranch ph e sec 02behrens ranch ph f sec 01b eilersbel-air addbel air , sherwood shoresbel air condo amdbel air condominiumsbel air estatesbel air sherwood shoresbelcher w cbeldin, johnbelhaven sec 01belhaven sec 02bella charcabella charca add ph iibella charca add ph ivbella charca ph 8bella charca phase 11bella charca phase 12bella charca phase ixbella charca ph iibella charca ph ixbella charca ph vbella charca ph viibella charca ph viiibella charca ph xbella charca ph xibella charca sec ibella charca sec iiibella charca sec vibella colinasbella colinas sec 1bella colinas sec 2bella colinas sec 7, 8, & 9bella colinas sec 7,8,& 9bella colinas secs 3,4,5 & 6bella fortunabella fortuna ph 2 subbella fortuna phs 1bellairebellaire 1st extbellaire add sec ibellaire estatesbellaire harbellaire heightsbellaire heights 1st extbellaire heights 2ndbellaire heights 2nd ext replabellaire heights sec 01bellaire north sec 2bellaire north sec 3bellaire north sec 5bellaire north sec 7bella montagnabella montagna, round mountain estates 02bella montagna estates (round mountain estates)bella montagna round mountain estates 02bellamybella rosabella rosa subbella serabella stradabella terrabella terra condo amdbella terra condo ph 03 amdbella terra ph 3bella terra phase iiibella terra ph ibella terra ph iibella terra ph iiibella vistabella vista at cottonwood creekbella vista cottagesbella vista north condominiumsbella vista north condosbella vista sec 01bella vista sec 03bbella vista sec 05bell countybelle oaksbelle oaks ranchbelle oaks ranch phase 1belle oaks ranch phase iibelle oaks ranch phase iiibelle oaks ranch phase viiibelle oaks ranch ph vbelle terrebellevuebell farmsbell farms ph 1abell farms ph 1bbell farms ph 2a amdbell farms phs 1-abell farms sub ph 4bellingham mdws ph 2 sec 2bellingham mdws ph il sec 3bellingham mdws sec 2bellingham meadowbellingham meadowsbellingham meadows sec 1bell jamesbell j dbell meadebell meadows sec 03bello vistabellows additionbell s/dbell spgs ranchesbell texbell tierra westbelltower ibelltower unit iibelltower unit ivbellviewbellview addbellvillebellvue parkbel meadebelmontbelmont estatebelmont estatesbelmont gardens 1 & 3belmont parkbelterrabelterra ph 02 sec 02belterra ph 1 sec 3abelterra ph 1 sec 6abelterra ph 1 sec 8belterra ph 2 sec 5dbelterra ph 3 sec 11abelterra ph 4 sec 12abelterra ph 4 sec 12bbelterra ph 4 sec 13belterra ph 4 sec 14belterra ph 4 sec 18belterra ph 4 sec 19bbelterra ph ii sec 2belterra ph ii sec 9abelterra ph ii sec 9bbelterra sec 11abelterra sec 15belterra sec 17belterra sec 21-2beltonbelton indust park repbelton originalbeltorrebelvederebelvedere ph 01belvedere ph 02belvedere ph 03belvedere ph 04belvedere ph ii-a rev plabelvedere ph vii-abelvedere ph v rev lt 28 bl dben arnoldben arnold ranchbenavides heightsbenbrook ranchbenbrook ranch ph 2b sec 2benbrook ranch sec 01 ph 01benbrook ranch sec 01 ph 02benbrook ranch sec 02 ph 01benchmarkbenchmark condobenchmark condo amdbendbend/post oak ph 2bend/post oak ph iibend at nuckols crossing ph 01bend condominiumsbend condosbendelebenites mobile home parkbenjamin f hanna surveybenjamin fuquabenjamin mckinney surv #3 absbenner farmsbennie hicksbensons subdbentleybentley manorbentleys home addbent oak ranchesbenton schulze propertiesbenton schulze properties #21bent treebent tree / stone oak/the heights/fawnwaybent tree condosbent tree estates ph 1bent tree estates ph iiibent tree sec 01bent tree sec 02bentwater 05bentwoodbentwood phase ivbentwood ph iibentwood ph iiibentwood ph ivbentwood ranchbentwood ranch unit #5berclairberdoll farmsberdoll farms ph 02 sec 01berdoll farms ph 02 sec 02berdoll farms ph 02 sec 03bergfeldbergfeld addbergheimbergman valley viewbergwaldberkman tower view subbernardoberry, esther, acres 4.558berry creekberry creek highlandsberry creek sec 02berry creek sec 04berry creek sec 05 ph 01berry creek sec 06 resubdberry creek sec 08 ph 01 resub pts blk b kberry creek sec 11 ph 01berry creek sec 11 ph 02berry creek sec 11 ph 03berry crk hlnds ph 1bberry crk ph 2 sec 5berry crk sec 02berry crk sec 08 ph 01 resubberry estatesberry oaks comalberry spgs condosberry springsberry springs condosbertrambertram citybertram creekside ranchesbertram gardensbertram oaksbertram oaks ph 1bertram woodsbeteda subdivisionbetesda subdivisionbethke acresbetty levybetty levy thbetty levy th some exemptbeulah bluff estates ph onebeulah bluff estates ph twobeverly estatesbeverly hillsbevil j surbexarbexar cobexar sub ncb 13760bf hanna surv abs #222bible addbielstein subdivision/leakeybiermanbig bee creekbig bee creek 02big bee creek subdbig countrybig country gdn homesbig country sec 1big country sec 4big country sec 5big creekbig creek estatesbig creek ranchbig creek ranch ph twobig crk ranch ph 1big crk ranch ph 2big drawbig easy ranchbigfootbig shadesbig sky ranchbig sky ranch final plat at dripping spgsbig sky ranch ph 1 at dripping spgsbig sky ranch ph 2 at dripping spgsbig sky ranch ph 3 at dripping spgsbig sky ranch ph 4 at dripping spgsbig sky ranch ph one at dripping spgsbig springbig springsbig wellsbig wells-orig townbig wells-orig town, block 13, lot 1-8bil-mar estatebills add sec 01bil mar estate 3rd extbindseil farmsbinion creekbinion crk estatebirch creek estatesbird creek valley ph ibirdlipbird nest subbirkdale areabirkner add 03birmensdorf farmsbisang a addbisdnbishopbishop addbishop crossing sec 2bishop crossing sub sec 1bison ridgebison ridge at westpointebissell tbisset r surbissettbitters bendb k stewartblb l & i coblack, josephblack a k 01black a k 02black a k subd no 1blackbuckblackbuck ranchblack buck ranch at burnetblackhawkblackhawk at bulverde villageblack heirsblack hill ranchblack hills estatesblacklandblackland ranchblackland ranch addblackmanblack rock estatesblacksmith ranchblackwoods subblake manorblake manor eco-development sublake t mblakeyblakey, nancyblalock, james bblancoblanco bendblanco bend #1blanco bluffsblanco gardensblanco river crossingblanco river crossing sec 2blanco river estatesblanco river ranch estatesblanco river rapidsblanco river villageblanco river village condoblanco river village condominiumsblanco river village for greenwayblanco river village no2 condoblanco river village sec oneblanco road office park bl 17061blanco terraceblanco vistablanco vista 1-ablanco vista heritage pointblanco vista ph 1-ablanco vista ph 3 sec 1blanco vista tr ablanco vista tr c-2blanco vista tr dblanco vista tr e-1blanco vista tr e-2blanco vista tr e-3blanco vista tr g-hblanco vista tr i sec a & school trblanco vista tr k-1blanco vista tr lblanco vista tr m-1blanco vista tr m-2blanco vista tr nblanco vista tr q sec 1blanco vista tr s-tblanco woodsblankenship/carruthersblanket o tblanton survblassingame subblessingblessing ranch subblock 060 original cityblock 077 original cityblock 079 original cityblock 088 original cityblock 097 original cityblock 21 condosblock 102 original cityblock 111 original cityblock 129 original cityblock 177 original cityblock 1035block 1334block 11691block c los milagros ph 1 bblock house ceeek ph d sec 05block house creekblock house creek ph c sec 01block house creek ph c sec 02block house creek ph d sec 01block house creek ph d sec 02block house creek ph d sec 03block house creek ph d sec 05block house creek ph d sec 608block house creek ph e sec 608ablock house creek ph e sec 612block house creek ph f sec 02block house creek ph gblock house crk ph d sec 04block house crk ph e sec 614block house crk ph gbloomfield hillsbloomingtonblossom hillsblossom hills & blossom hillsblossom parkblossom ranchblue bird condominiumsblue bird heightsbluebonnetblue bonnet acresbluebonnet acresbluebonnet acres sec 1bluebonnet estatesblue bonnet gardensblue bonnet hillsbluebonnet lane cityhomes condobluebonnet loftsbluebonnet lofts condosbluebonnet mdwsbluebonnet meadowsbluebonnet ranchbluebonnet trls subblue country estatesblue cove estatesblue creek ranchblue heron subbluehill nsbluejay square resub 1blue lake estatesblue oaksblue propertiesblue properties sec bblue properties sec cblue properties sec fblue properties section ablue rdg ranch sub un 1c ncb 1blue ridgeblueridgeblue ridge estatesblue ridge ranchblue rock springsblue skies ut-1blue sky estatesblue sky ranchbluestembluestem estatesbluestem estates 2nd unitbluestem reserveblue waterblue water estatesblue wing trailsbluff creek ranchbluff havenbluffington sec 01bluffington sec 02bluffington sec 02 resubbluffs/crystal falls ph 1b secbluffs/crystal falls ph 3h secbluffs/crystal falls ph 31 secbluffs/crystal falls sec 3 phbluffs/crystal falls sec i phbluffs at crystal fallsbluffs at crystal falls, bluffs/crystal falls ph 3bluffs at crystal falls sec 2bluffs at crystal falls sec 3bluffs at westchasebluffs condo amdbluffs great hillsbluffs of lookout canyonbluffs of university hills sec 3bluffs on the guadalupebluff springs estatesbluffs sec 01 at villages spicewoodbluffs sec 1 at the villages obluffs the amdbluffs the amd amd plabluffs the amended hollowsbluffs university hillsbluffs university hills sec 01bluffs university hills sec 03blufftonbluff viewbluffview 50'sbluffview 50sbluffview 60'sbluffview estatesbluffview greensbluffview greens nebluffview heightsbluffview of caminobluffview ph 1bluffview ph 3bluffview reserveb manlove surv abs #417b mcdanielboardwalkboardwalk at alexanderboathouse dockominiumsboat shop devbobcat rdgbob cooper addnboca chicaboca chica sub sec 3 ph 1 aboca chica viiiboca raton townhousesboeckerboehme ranchboeing subdivision/ tom williams subdivisionboerneboerne heightsboerne hollowboerne original townboesleger jbohls 2 addbohls 5 addbohls place sec 04-abohls place sec 05bohls place sec 06bohls place sec 07bohls place sec 08bohmebold creekbollingerbolm road acresbombick hillbon-airebon-aire resub 1bonanza beachbonhambonham a l dbonham placebonita vistabonnetbonnet tr subbonneu estates- lots 1,2,3&4bonorden port lavacabon tonbon winde oaksboothboot ranchboot ranch #1boot ranch subboot ranch sub ph 2 sec 21booty & lesueur addbordeaux estatesborder housing unit 1borders nancy knop amdborho ph 2borho ph 3borho ph 6borho ph 10botello c sur aw00710bottoms east estatesboulder creekboulders/crystal falls ph iiiboulders at canyon springsboulders at crystal falls ph 01boulders at crystal falls ph 04boulders at crystal falls ph 05bouldinbouldin & daniel condominiumsbouldin add north extbouldin court condosbouldin creekbouldin creek condo amdbouldin creek cottages amdbouldin james e addbouldin j e estatebouldin neighborhoodbouldin oaks 02bouldin south extboulevardboulevard a condo amdboulevard at lakewayboulevard heightsbowdenbowles, benjaminbowling greenboxwoodboxwood-lawn subboxwood-lawn sub resub 2boxwood of taylorboxwoods at taylorboydbracewood subbrackenridgebrackenridges addbrackettvillebrackin williambradbury courtbradbury court subbrademanbradfield village section twobradfield village sec twobradford meadowsbradford oaksbradford park sec 01bradford park sec 1bradford park sec 2 ph 1bradford park sec 2 ph 3bradford park sec 3abradford subdivisionbradley business parkbradley bus park condosbradshawbradshaw addbradshaw crossingbradshaw crossing / zachary scott sec 02bradshaw crossingsbradshaw crossing sec 03bradshaw crossing sec 04bradshaw crossing subbradshaw crossing sub sec 6bradshaw crossing sub sec 7bradshaw crossing sub sec 8bradshaw crossing sub sec 9bradshaw crossing sub sec 10bradshaw crossing sub sec 11bradshaw xing sub sec 7bradshaw xing sub sec 12bradybrady gardensbraes ridge add sec 01braes ridge add sec 02braes ridge add sec 03braewoodbrahmans drawbramble bushbranch addbranch creek estates mh parkbranch hbranchwater estatesbranchwater estates subbrandywine condo amdbrandywine condominiums amendedbranson woodbrasshollowbrasshollow additionbratton hillbratton hill sec 01bratton hill sec 02bratton park sec 02bratton park sec 1braun farmbraunfels heigbts ncb 5007braun heightsbraunigbraunig lake area ecbraunig ranch estatesbraun landingsbraun oaksbraun pointbraun ridgebraun stationbraun station eastbraun station westbraun willowbrazoriabrazos place condo amdbrazos reservebreakaway parkbreakaway park sec 1breakaway park sec 1abreakaway park sec 3breakaway park sec 4breakaway park sec 5breakaway park sec 5 ph 2breakwaterbreakwater point subbreckenridgebreezes at sonterrabreezy hollow add sec 01breezy hollow add sec 02breezy hollow add sec 03breezy river ranchbremondbremser addbrenhambrentfieldbrentwoodbrentwood commonbrentwood manorbrentwood manor resub 1brentwood oaksbrentwood terracebrentwood villasbrewer additionbrewester addbrewster b fbrewster florence replatbriana y wadebriarcliffbriar cliffbriarcliff inc sec 04briarcliff inc sec 05briarcliff inc sec 06briarcliff inc sec 07briarcliff inc sec 08briarcliff inc sec 09 amdbriarcliff inc sec 10briarcliff inc sec 11briarcliff inc sec 12briarcliff inc sec 13briarcliff inc sec 14briarcliff inc sec 15briarcliff inc sec 16briarcreek sec 01briarcreek sec 03briarcreek sec 04briarcreek sec 05briarcreek subd sec 1briarcreek subd sec 3briarcreek sub sec 6-abriarcreek sub sec 6-cbriar crestbriar placebriarwickbriarwoodbriarwood estates ph ivbriarwood estates ph twobriarwood knoll sec 01 resubbriarwood sec 01briarwood sec 02briarwood sec 03briarwood sec 04briarwood sec 04 repbriawickbricewoodbridelgatebridge at arella lakelinebridge at sterling springsbridge at terracinabridge at the kenziebridge at volentebridgehavenbridgehaven parks at westhavenbridgehaven ph 1bridge hillbridgepointbridges at bear creek ph 1 sebridges at bear creek ph 2 sebridges condo nsbridges of bear creek ph 1 sebridges on the park amdbridges sigmund subbridgestone ranchesbridgestone sec 02bridgeview estatesbridge water ranch wilson countybridgewoodbridgewood addbridgewood additionbridgewood add ph iibridgewood add ph iiibridgewood sub nsbridgewood sub ph 2bridle gatebridlegatebridlegate 1bridlegate 3bridlegate ranchbridle ridgebridle ridge iiibridlewoodbridlewood parkbridle wood ranchesbridle wood ranches sec 2brigadoon townhomesbrigadoon twnhms ph 02briggsbriggs estatesbriggs ranchbrighton placebrill arno 02 amdbrim place vbrinwoodbrinwood sec 01brinwood sec 02brinwood sec 03brinwood sec 04brisa estatesbrisasbristol forestbristol placebristow bendbritish commonsbrkhaven/starlit/grn meadowbroadacresbroadhead additionbroadview/quill ns/sabroadview terracebroadway estatesbroadway estates 1broadway estates 2brock add ph twobrodbentbrodie estatesbrodie heightsbrodie heights condo amdbrodie spgs 02 ph 01broken arrow lake estates secbroken oakbroken oak subbrooke add ph twobrookefieldbrookfieldbrookfield estatesbrookfield estates 02brook havenbrook haven heights add ncb 9877brookhaven ph fourbrookhaven ph onebrookhaven ph twobrookhaven ph two rep lbrookhillbrookhill subbrook hollowbrookhollow 1 port lavacabrookhollow 2 port lavacabrookhollow 3 port lavacabrookhollow 4 port lavacabrookhollow 6 port lavacabrook hollow add sec 01brook hollow add sec 02brookhollow club estatesbrookhollow estates port lavabrookhollow estates port lavacabrook hollow nebrookhollow sec 01brookhollow sub sec 2brooklandsbrooklands sec 1brooklands sec 2brooklands sec 3brooklands sec 4brooklands sec 6brook meadowbrookmeadowbrook meadow sec 1brookmillbrooksbrooksdalebrookshirebrooks hollow resubbrooksidebrookside annexbrookside estatesbrookside ph 01brookside ph 1brookside ph 2brookside ph 4brookside phase 2brookside phase iiibrookside subbrookside villas condo amdbrooks ranchbrooks ranch ph 2brooks subbrooks subdbrookstonebrookstone creekbrooksville addbrookwoodbrookwood/crestwoodbrookwood/crestwoodjdnebrookwood addbrownbrown, elizabethbrown-bland-allenbrown-dossettbrown addbrown bldg lofts condo amdbrowndellbrown herman addbrown herman add 02 sec 04brown herman add 02 sec 05brownleaf estatesbrown m l addbrown rock springsbrownsonbrownson road subdivision #2brownson terrace iibrowns sub abrownstone/summit ph 2 3 &brownstone at the summitbrownstone farmsbrown subbrownsvillebrownwoodbruce co subbruce road acres s/d lot 3 14.017bruceville-eddybruceville eddybrunerbruns bauerbrushmastersbrushmasters ii subbrushy bend parkbrushy bend park sec 2brushy creekbrushy creek estatesbrushy creek loopbrushy creek meadows sec 01brushy creek meadows sec 02brushy creek meadows sec 03brushy creek north sec 01brushy creek north sec 02brushy creek ranchbrushy creek sec 01 or southbrushy creek sec 02brushy creek sec 02 amd lts 01-12 blk 12 lbrushy creek sec 04brushy creek sec 05brushy creek village pudbrushy crk village sec 02brushy point estatesbrushy slope sec 03brushy topbruton spgsbruton springs subdbryanbryan's 2ndbryce placebrycewoodbrykerwoods annexbrykerwoods annex 02brykerwoods annex 02 resubbrykerwoods bbrykerwoods cbrykerwoods ebrykerwoods fbrykerwoods resub of lts 10-12brysonbryson ph 1 sec 1bbryson ph 1 sec 1e finalbryson ph 1 sec 18bryson ph 2 sec 1bryson ph 3 sec 2bryson ph 3 sec 3bryson ph 4 sec 3bryson ph 4 sec 5bryson ph 5 sec 1bryson ph 5 sec 2bryson ph 6bryson ph 10 sec 1bryson ph 10 sec 2bryson ph 11 sec 1b strunkbtb twisted subdivisionbubuchanan dambuchanan lake villagebuchanan lake villiagebuchanan subdbuchel karnes citybuckholtsbuckholts otbuck horn ranch 2buckingham estatesbuckingham estates ph 02 sec 01buckingham estates ph 04 sec abuckingham estates ph 04 sec bbuckingham estates ph 2 sec 2buckingham estates ph 3 sec 3buckingham estates ph 3 sec 4buckingham estates ph 3 sec 5buckingham estates ph iii secbuckingham estates sec 01buckingham estates sec 02buckingham placebuckingham place comm areabuckingham place sec 02buckingham place sec 05buckingham rdg sec 5buckingham ridge sec 01buckingham ridge sec 02buckingham ridge sec 04buckingham ridge sec 05buckmanbuckman obudabuddingtonbuddy & pete bakerdbuena vistabuena vista 02 amdbuena vista addbuena vista condobuena vista condominiumsbuena vista estatesbuena vista westbuffalo creek ranchbuffalo crk ranchbuffalo crossingbuffalo crossing #4buffalo gapbuffalo passbuffalo rdg ph onebuffalo ridgebuffalo spgs ranchbuffalo springs ranchbugtussle additionbuhler addbuilding blkbullardbull creek ranch condo amdbull hide estatesbull mountain ph 01bull mountain ph 02bull mountain ph 04 sec 01bulverdebulverde 3/ villages ofbulverde creekbulverde creek / enclave atbulverde creek / woodview @bulverde estatesbulverde gardensbulverde hillsbulverde villagebulverde village-blkhwk/crkhvnbulverde village-strtfd/trnbrybulverde village/the pointbumblebee acresbungalowsbungalows at the forty acres cbungalows at the forty acres condobunker ranchbunker ranch 5 condobunker ranch ph 1bunker ranch ph 2bunker ranch ph 3bunker ranch ph 4bunnellbunny bend condo amdbunny trail estates ph onebunny trail estates ph twobunny trail villagebunny trl vlgbunret oaksbuntebunton creekbunton creek ph 1-abunton creek ph 1bbunton creek ph 2abunton creek ph 3bunton creek ph 4bunton creek ph 5bunton creek ph 6bbunton creek ph 6cbunton creek reserve ph 1bunton creek reserve ph 2bunton creek reserve ph 3buratti & chericoburchard addburch ida mae estateburger ridge estatesburkeshireburkeshire port lavacaburkhead addburlesonburleson, jonathanburlingtonburnetburnet 64 condominiumsburnet 64 condosburnet cnty regburnet countyburnet heightsburnet hill top estatesburnet hilltop estatesburnet oaksburnet oaks estatesburnet road terrace resubburnett ranchburnett ranch sec 1burnett ranch sec 2burnett ranch sec 3burnett ranch sec 5burning treeburning tree condos bldg cburning woodburning wood/meadowwoodburnsburns-yakeyburns partition burns 2ndburns series 01burns s m burns 1stburns street condominiumsburns street condosburr h duval tract 4burtonburton & danforthburton, john mburton karnes city 03bushbush ranch ph 1 revbusiness personal propertybutler, johnbutler-moore addbutler farmsbutler farms ph 2 3 & 4butler farms ph 7butler farms ph 9butler ranch estatesbuttercup creekbuttercup creek ph 04 sec 01-2 amdbuttercup creek ph 04 sec 03buttercup creek ph 04 sec 04buttercup creek ph 04 sec 09buttercup creek ph 05 sec 01-abuttercup creek ph 05 sec 01-bbuttercup creek ph 05 sec 02buttercup creek ph 05 sec 03buttercup creek ph 05 sec 08buttercup creek ph 4 sec 1-2buttercup creek phv sec 11buttercup creek sec 01 village 01bbuttercup creek sec 01 village 03buttercup creek sec 02 village 01buttercup creek sec 02 village 02buttercup creek sec 02 village 04buttercup creek sec 02 village 05buttercup creek sec 02 village 06buttercup creek sec 02 village 09buttercup creek sec 03 village 01buttercup creek sec 03 village 02buttercup creek sec 03 village 05-abuttercup creek sec 03 village 05-h amdbuttercup crk ph 04 sec 05buttercup crk ph vbuttercup crk ph v sec 01-bbuttercup crk sec 02 village 04buttercup crk sec 03 village 01buttercup crk sec 2 village 4buttercup twnhmsbutterfield ranchbutterfly meadowsbwb w breeding addbybeesbyerley wm. sur.byler addbymer, bernardbynum avebyram addnbyrdbyrd lockhart-mcdowell addn.byrd lockhart surv #8 abs 17byrd lockhart surv a-017byrd lockhart surv abs #17byrd ranch at miller creekbyrd ranch estatebyrd ranch estatesbyrnebyrnes jamesc & h acresc-sh21-airc-us290ec-wim-sqc.p. lester homeownersc0050c458-ih352 ih35 nbcaballo ranchcaballo ranch sec 01caballo ranch sec 02caballo ranch sec 3caballo ranch sec 4caballo ranch sec 5cabelas sec three, block b, lot 7ccabins/reservecactus creek ph onecactus crk ph onec a d clamp survey, a-167 & m a irvine survey, a-7cade lake sec 4cade lake sec 6cadillac canyoncadillac canyon 1cadillac canyon 2cage & boonec a kessler addcalais villascalallencalallen southcalavan estatescalaveras lake ranchcalders cornercaldwellcaldwell wcaledoniancalhoun subdivisioncaliche hill sec 2caliterracaliterra - 80'caliterra - 100'caliterra - 110'caliterra ph 5 sec 14caliterra ph four sec 11caliterra ph four sec 12caliterra ph one sec fourcaliterra ph one sec twocaliterra ph three sec ninecaliterra ph two sec. fourteencaliterra ph two sec eightcalizacaliza reservecaliza springscall agentcallaghan placecallander lakecallender lakecallender oak grovecallie christina estatescallis #1calnetcalumetcalumet subdivision phase 3,4,5calumet sub ph 1calumet sub ph 3 4 & 5calumet sub ph icalvertcambridgecambridge condo amdcambridge estatescambridge estates sec 01cambridge estates sec 02cambridge estates sec 03cambridge heightscambridge heights ph a sec 01-acambridge heights ph a sec 1-cambridge heights ph b sec 01cambridge heights ph b sec 02cambridge heights ph c sec 1rcambridge villagecamden placecamelotcamelot 1camelot forrestcamelot iicamelot sec 01camelot sec 03camelot sec 05camelot sub bl 16919 un 20acamelot sub un 56camelot twnhse sub un 33 ncb 1cameroncameron add 2cameron addn.cameron e ecameron lucille resubcameron parkcameron park sec 02cameron park sec 3cameron placecameron subcameron woodscameros ranch sec 3camilla twin harbors #1camino banderacamino realcamino real/bluffviewcamino real subdivisioncamino verdecamp addcampanascampbellcampbell & zandersoncampbell creek acrescampbell poccampbelltoncampbellton acrescampbellton gardenscampbelton ranchcamp creekcamp creek w ccampestres at cascadacampfire 2campfire 2 edgewatercampfire 2 sec 1campo colinascamp swift cabinscamp swift estatescamp swift ranchcampus at lakewood ranchcampus at lakewood ranch phcampus heightscamp verdecamp woodcamp wood hillscamp wood hills, camp woodcamp wyattcanada verdecandelara ranchcandle light northcandlewoodcandlewood parkcaney creek estatescanham ranchcanham ranch 1cannizzo sec 03cannon addcannon north subcannon professional park condocannon ranchcannon ranch sub ph 1cannon ridge condo amdcannon subcannon westcanopy/westgate grove condoscanopy/westgate grove condos b-7canopy at hudson bendcanopy at hudson bend condomincanopy at westgate grove condominiumscanopy condocanopy of westgate grove condominiumcantarracantarra 1 northcantarra eastcantarra east 50'scantarra meadowcantarra meadow 40'scantarra meadowscantarra sec 01cantarra sec 2a-2cantarra sec iia-2cantarra sec iib-1 subcantarra sec iib-2 subcantarra sec iiiacantarra sec iiibcantarra sec ii ph 3cantarra sec ivcantera hillscantera manor enclavecantera villagecantera vista condocanterbury courtcanterbury farmscanterbury squarecanterbury trails sec 02canterbury trails sec 03canterbury trails sec 04canterbury trails sec 05canterbury trails sec vcanterfieldcanterfield ii nscantu addcanutillo colony ditch co survcanyoncanyon at scenic loopcanyon cove estatescanyon creekcanyon creek bluffcanyon creek ph icanyon creek ph iicanyon creek ph iiicanyon creek ph ivcanyon creek ph ixcanyon creek ph vicanyon creek ph viicanyon creek ph viiicanyon creek ph v rep bcanyon creek preservecanyon creek sec 01canyon creek sec 11canyon creek sec 17bcanyon creek sec 17ccanyon creek sec 19acanyon creek sec 20canyon creek sec 22canyon creek sec 23canyon creek sec 24canyon creek sec 25canyon creek sec 26canyon creek sec 28canyon creek sec 29canyon creek villagecanyon creek westcanyon crestcanyon crossingcanyon crossing ut-7canyon dam hillsitecanyon estates un #1canyon heightscanyon lakecanyon lake acrescanyon lake acres, unit no.2canyon lake acres 1canyon lake acres 2canyon lake acres no.2canyon lake acrrescanyon lake estatescanyon lake estates 1canyon lake estates section 1canyon lake forestcanyon lake forest 1canyon lake forest 2canyon lake forest 3canyon lake hillscanyon lake hills 1canyon lake hills 2canyon lake hills 3canyon lake hills 4canyon lake hills 5canyon lake hills 6canyon lake hilolscanyon lake islandcanyon lake mh estates 5canyon lake mh estates north 2canyon lake mh ests.canyon lake mobile homecanyon lake mobile home estatescanyon lake mobile homes estatescanyon lake shorescanyon lake shores 1canyon lake shores 2canyon lake shores 3canyon lake shores unit #3canyon lake villagecanyon lake village 1canyon lake village 2canyon lake village 3canyon lake village westcanyon lake village west 1canyon lake village west 2canyon lake village west 3canyon lake village west 5canyon lake villascanyon mesa ph 01canyon oakscanyon oaks estatescanyon oaks ph 02canyon oaks unit 4canyon parkecanyon park estates 2canyon ranch estatescanyon reservecanyon ridge ph a sec 02canyon ridge ph icanyon ridge ph iicanyon ridge ph iiicanyon ridge spgscanyon ridge springscanyon rimcanyonscanyons at lake traviscanyons at scenic loopcanyons at stone oakcanyonside/falconhead west condoscanyonside at falconhead westcanyon spgs resort 1canyon spgs resort 2canyon spgs resort 3acanyon spgs resort 4canyon spgs resort 5canyon springscanyon springs necanyon springs ranchcanyon springs resortcanyon viewcanyon view acrescanyon view acres 2canyon view estatescanyon vistacanyon vista 1canyon vista amdcape carancahuacape carancahua 01cape carancahua 02cape carancahua 03cape carancahua 04cape carancahua 05cape carancahua bus parkcape lago condocape royalecape shorescape shores subcape terracecapistranocapistrano condominiumscapital a condominiums at lamppostcapitol hillcapitol view estatescap rockcaprockcap rock estates at crystal fallscapstone estatecapstone estatescapstone estates ph icapstone estates ph iii sec icapstone estates ph ii sec icapstone estates ph i resubcaptains corner subdivisioncaracolcaracol creekcaracol heightscaracol poccardinal crossingcardinal crossing condominiumscardinal hillscardinal hills condo amcardinal hills condominiumscardinal hills estatescardinal hills estates unit 11cardinal hills estates unit 12cardinal hills estates unit 13cardinal hills estates unit 14cardinal hills estates unit 15cardinal hills estates unit 16cardinal hills unit 01cardinal hills unit 02cardinal hills unit 03cardinal hills unit 04cardinal hills unit 04acardinal hills unit 05cardinal hills unit 06cardinal hills unit 07cardinal hills unit 5 amdcardinal mhpcardinal ridgecardinal xing condoscardoncaribbean condominiumscaribbean condominiums amendedcarilloncarillon manor heightscarlsoncarlson addncarlson park p.u.d.carlson placecarlson place ph ecarltoncarmean, johncarmelcarmel 50scarmel creekcarmel estatescarmel hillscarmel ranchcarmel westcarmel west ph 1 sec 1carmel west ph 2 sec 1carmel west ph 2 sec 2carmel west ph 2 sec 5carmel west ph 3 sec 1carmel west ph 3 sec 2carmel west phase 2carmel west phase 2 section 3carminecarmona hillscarneros ranchcarneros ranch sec 1carneros ranch sec 3carneros ranch sec 4carolina crossingcarolina crossing 2/caroline brown surv abs #91carol mdws sec 2carol meadowscarol meadows sec 01carouthers j surcarpenter hillcarpenter hill sec 2carpenter hill sec 3carpenter hill sec 4carrcarrell oaks sec 01carrell oaks sec 02carrells cornercarriage hill 2 sec 4carriage hillscarriage hills #2carriage hills 02 sec 04carriage hills 2 sec 1carriage hills 2 sec 5carriage hills 3 sec 2carriage hills 3 sec 3carriage hills 3 sec 4carriage hills 3 sec 5carriage hills cedar park onecarriage hills sec 01carriage hills sec 01 amdcarriage hills sec 01 rep pt cedar pcarriage hills sec 02carriage hills sec 03carriage hills sec 1carriage house trailcarriage house trails ph icarriage house village phase icarriage house village ph icarriage oaks estate ph 1carriage park condocarriage pointe resubd 1carringtoncarrington courtcarrington ranch - wild countrycarrington ranch ph 01carrington subdcarrizo hillcarrizo hill subd #1carrizo ranch subcarrizo springscarroll & hofheinzcarrolls l wcarsoncarson creek addcarson creek addn sec 2carson creek sec 04carson ranchcarson wm h 1/4 lgcartercarter glasscarter williamcarthage placecartwrightcartwright lotscartwright p surcaruthers, j. sur., acres 26.247carver terracecasa avilacasa blanca cove ph iii amendecasa del mar condocasanobacasas navarretecasa subd, lot 7, acres 1.022casa verde condocascada at canyon lakecascada canyon lake 1cascada canyon lake 3cascada condo amdcascadecascade condominiumscascade condoscascade mobile villagecascade moble villagecascades/onion crk east ph 1cascades/onion crk east ph 2cascades at onion creekcasetta ranchcasetta ranch sec 1casetta ranch sec 2casetta ranch sec 3casinas at gruenecasinas at prue crossingcasitas at avery ranch 02 amdcasner, isaaccasner jcasocaso leandercassanova, franciscocassiano homescassiecastellcastle acrescastleberrycastleberry, sarah ccastle east subcastle forestcastlegate ii sec 206castlegate sec 05 ph 02castle heights blks a-dcastle heights blks e-fcastle heights blks k-ycastle hill estates iicastle hill iicastle hill iiicastle hill northcastle hill north icastle hill north iicastle hillscastle hills (sherwood shores)castle hills estatescastle hills forestcastle hills forest subdivisioncastle hills seg 1 & 2castle hills terracecastle hills west iicastle hill terrace condo amdcastle hill westcastle hill west iicastle hill west iiicastle lake ranchcastle mountaincastle mountain estatescastle parkcastle ridgecastle ridge #2castle ridge #3castle rockcastle rock sub ph 8castle royalecastle terracecastle viewcastle view ranchescastlewoodcastlewood annexcastlewood est eastcastlewood forest sec 07castlewood forest sec 09castlewood forest sec 6castlewood southcastlewood south ph 1castlewood sub ph 2 & 3castrovillecastroville country village unit 1castroville range 10castroville westcaswell lofts condocaswell place condocatalinacatalina ranchcatalpa place condominiumscat eddycaters parkviewcates ph #2cates phase #2cat hollowcat hollow condocat hollow condoscat hollow sec 01-acat hollow sec 03cat hollow sec 05cat hollow sec 05-acat hollow sec a ph 01cat hollow sec a ph 02cat hollow sec a ph 04cat hollow sec a ph 05cat hollow sec bcat hollow sec c ph icat mountaincat mountain villascat mountain villas sec 02cat mountain villas sec 03bcat mountain villas sec i03bcattlebaron parc iicattle creekcattleman's crossingcattleman's crossing unit 1cattleman squarecat_d_nueces_canyon_ruralcaughfield - larkspurcaughfield ph 2caughfield ph 3bcaughfield ph 4caughfield ph 7a, larkspurcaughfield ph 8caughfield ph 11caughfield ph ivcavallo parkcavalo creek estatescave wells ranchcayena condoscayena creeksidecb 6 dilleycb3009cb4017cb4019cb 4332l marbach village ut-1cb 5110cb 5474acb 5995c bendlec b rockwell, s riggs, a s word, j a lee, j campbellc b shain abstc b smith addccc diaz surcearley community subcedar bendcedar bluffcedar branch estatescedar break condocedar brookcedarbrook rdgcedarbrook rdg ph iicedarbrook ridge ph i amdcedar cliffcedar creekcedar creek estatescedar creek ninetycedar creek sec 2cedar creek sec 4cedarcrestcedar glen sec 01cedar glen sec 03cedar glen sec 1cedar grovecedar grove sec 1cedar heightscedar heights estates ph icedar hillcedar hill add ph icedar hillscedar hills sec 2 lot 154cedar hollow crossingcedar mountain estcedar parkcedar park / leandercedar park one sec 1cedar park ranchettescedar park ranchettes 02cedar park ranchettes 04 blcedar park ranchettes 06acedar park ranchettes 6acedar park ranchettes lo 06cedar park ranchettes resub ptcedar park ranchettes un 02cedar park ranchettes un 6cedar park ranchettes unit 2cedar park towncentercedar park town center condocedar park towncenter sec 1cedar park towncenter sec 2acedar park towncenter sec 2bcedar park towncenter sec 2ecedar park towncenter sec 3cedar park towncenter sec 4cedar park towncenter sec 5cedar park towncenter sec 6cedar park towncenter sec 7cedar park towncenter sec 9cedar park towncenter sec 10cedar park villas condocedar pointcedar point sec 1cedar ridgecedar ridge estatecedar ridge estatescedar ridge ph 01cedarscedar springscedars the 2cedar terracecedar valleycedar view estatesc e gotcherc e kimbrough 56 acrec e kimbrough 56 acrecelestecelia's courtcelias court/908 nueces condocelias court condominiumscelias court condosceniza condocentennialcentennial condo rev 1997centennial rdg un 1centennial ridgecentennial sub seccentercenter/gattis condos bldg 1center 45center 45 bldg 7center 45 condoscenter at gattis condoscenter court townhomescenter court twnhmscentero at stone oakcenter pointcenterpointcenter point courtcenter point estatescenterpoint meadows subcenter point northcentervillecentral business districtcentral commerce office condomcentral east central eccentral georgetowncentral insurance addcentral parkcentral park # 4central park (salem center resub of lt b-1)central texas archery commercialcentro plazacentury acrescentury condocentury oakscentury oaks estatescentury oaks sub-un 1century oaks two subdcentury park condocentury park condominiumcep ittg & mfg so sv-600cerca at the domain condominiumscf torezynsky suvy 923 abs 781c g addchafin placechalk bluffchalmers addchama tracechamberlain addchamberlin ranch subchamberlin ranch subdchambers subchambord condominiums - revised 199chambord condo rev 1999chamonix condo amdchamonix condominiumschamonix condominiums amendechamonix owners association, inc.championchampion 360 subdchampion heightschampion heights - kendall countychampion parkchampions/river bendchampions at river bendchampions forestchampions lakewaychampions landingchampions manorchampions parkchampion springschampions ridgechampions runchampions villagechampions village 1champions village 2chancy williamschandlerchandler addnchandler cornerchandler creekchandler creek condo ph 01-bchandler creek sec 06achandler creek sec 06b replacementchandler creek sec 14chandler creek sec 16chandler creek sec 19chandler creek sec 21chandler creek sec 22chandler crk sec 07bchandler crk sec 12chandler crossingchannel oakschannel oaks 2channel oaks iichannel oaks sec. 2channel oaks sec iichannelviewchantzchantz add ph onechantz add ph threechaparralchaparral #2chaparral creek additionchaparral crossingchaparral crossing condo amdchaparral estateschaparral park sec 1chaparral park sec 4chaparral ranchchaparral ranchchaparro estateschapel hill northchapel hill north sec 02chapel hill north sec 03chapel hill north sec 03 resubchapman doylechapman estates subchapman estates subdchapman ests subchapparo estateschappell hillchaqueta amarillachariots landingcharlescharles cavanaughcharles cavanaugh league abs 1charles cronea a-120 (called john smith league)charles hendersoncharles m. cannoncharleston parkecharleston parke #2charleston place 02charleston place i-bcharles wilcox survcharlie miller addcharlie miller add repcharlie womackcharlottecharlotte vly south sec 7charmwood estatescharro vistacharter oakscharter oaks condo nschartwellchase 02 resubchase manor ph threechasewoodchas johnson surv #55 abs 385chateau dijonchateau dijon twnhms bldg cchatelet subc h delaney sur abs 181cheeverschelsea creekchelsea crossingchelsea subcherbourg squarecherbourg square condo ahcherico 01cherico 02cherlyton hillschernoskychernosky 02chernosky 04chernosky 06chernosky 07chernosky 08chernosky 09chernosky 10chernosky 11chernosky 12chernosky 14chernosky 15chernosky 16chernosky 17chernosky m echernosky no 8chernosky no 9chernosky no 12cherokee comm subdivisiocherokee hillscherokee lanecherrycherry creekcherry creek 02cherry creek 03cherry creek comm 03cherry creek eastcherry creek ph 02 sec 01cherry creek ph 03 sec 01cherry creek ph 03 sec 03cherry creek ph 03 sec 04cherry creek ph 04 sec 02cherry creek ph 06 sec 01cherry creek ph 06 sec 02 amdcherry creek ph 06 sec 03cherry creek ph 06 sec 05cherry creek ph 07 sec 02cherry creek ph 07 sec 03cherry creek ph 07 sec 06cherry creek ph 08 sec 02-acherry creek ph 08 sec 03cherry creek ph 08 sec 05-acherry creek ph iv sec 1 resucherry creek phs ii sec 3cherry creek phs ii sec 4cherry creek ph v sec 01cherry creek sec 02 ph 03cherry creek sec 09-acherry creek sec 09-fcherry creek sec 10-acherry creek sec 13cherry creek sec 14cherry creek sec 17cherry creek vcherry hill parkcherry hillscherry hollow estatescherry hollow estates sec 02cherry lane city homes condocherrylawncherrylawn sec 04 resubcherrylawn sec 05cherrylawn sec 06cherrylawn sec 5cherry meadowscherry moderncherry mountain ph 02cherry mtn acscherry ridgecherry ridge ranchcherrywoodcherrywood annexcherylton hillschesapeake condochester ranch placechestnutchestnut commonschestnut commons a condochestnut springschestnut square condochestnut square condominiumcheyenne moutain ests third uncheyenne mt 3rdcheyenne mt estatecheyenne valleychichester at cleveland ctchick add ph twochick add ph viichiltonchimney cornerschimney corners 1stchimney corners twnhschimney cove estateschimney creek condochimneyhill 01 instlchimney hill estates 2nd replachimney hills northchimney oakschimney oaks at lake travischimney oaks at lake travis sechimney oaks at lake travis sec 01chimney oaks twnhschimney placechimney place iichina grovechina springchipman addchisholm crossingchisholm loop addchisholm park sec 1chisholm park sec 2chisholm ridge sec 2chisholm trail condoschisholm trail ph 1chisholm valley 3chisholm valley sec 01chisholm valley sec 05chisholm valley southchisholm valley south sec 01chisholm valley south sec 04 ph 01chisholm valley south sec 4 phase 1chisholm valley south sec 11chisholm valley south sec 16chisholm valley west sec 03 amdchisholm vly sec 01chisholm vly west sec 03 amdchisum trailchoke canyon acreschontaleschristensen scenic river propchristian, thomaschristian house of prayerchristian ranchchristinechristopher condo homeschristopher condominium homeschristophers covechristopher subchristoph flack & john hornerchrist our kingchristoval rubio surv abs #274chula vistachula vista ranch subchunnchupik indust addchurchill estateschurchill farmschurchill forestchurchill gardens subchurch st condoschurch street condoschurchviewcibolocibolo bluffscibolo canyon/suenoscibolo canyonscibolo canyons/estanciacibolo canyons/monteverdecibolo crossingcibolo crossing creek frontcibolo northcibolo oaks landingcibolo oaks subdivisioncibolo parkcibolo ridgecibolo ridge estatescibolo sea-willow air park - focibolo valley heightscibolo valley ranchcibolo valley ranch #1cibolo valley ranch 8cibolo vistacibolo vistas phase #1cielo east city homescielo gardenscielo ranchcieloranchcielo ridgecielo riocielo rio ranchcielo spgscielo springscielo vista ranchcielo westcielo west city homescierra springscierra vistacima oaks condo ph icimarroncimarron hillscimarron hills/ranches of cimarron hillscimarron hills/the ranches of cimarron hillscimarron hills country clubcimarron hills ph 02 sec 01 pudcimarron hills ph 1 sec 1cimarron hills ph 1 sec 2cimarron hills ph 1 sec 3cimarron hills ph 2 sec 2cimarron hills ph 3 sec 2cimarron hills ph 3 sec 3cimarron icimarron iicimarron ivcimarron landingcimarron park 01cimarron ph iicimarron ph i repcimarron ph i replatcimarron professional park sec 02 ph 02cimarron sec 01cimarron sec 02cimarron sec 03cimarron sec 04cimarron sec 05cimarron sec 06cimarron sec 07cimarron trailcimarron trailscimarron un 16cimarron vcimarron valleycimmaron countrycinco lakescinco oakscinco ranch west sec 15cindy estates subdivisioncinnamon ridgecinnamon shorecinnamon shore southcircle c @ avana ph two sec twocircle c alta miracircle c golf estates ph 02circle c ph b sec 21circle c phs b sec 21circle c ranchcircle c ranch at greyrock ridge phase 3circle c ranch estatescircle c ranch estates amendedcircle c ranch hielscher sec 08circle c ranch ph a sec 01circle c ranch ph a sec 02circle c ranch ph a sec 05circle c ranch ph a sec 07circle c ranch ph b sec 01circle c ranch ph b sec 02circle c ranch ph b sec 03circle c ranch ph b sec 11circle c ranch ph b sec 13circle c ranch ph b sec 14circle c ranch ph b sec 16circle c ranch ph b sec 17circle c ranch ph c sec 03-bcircle c ranch ph c sec 08circle c ranch ph c sec 09circle c ranch phs b sec 1circle c ranch phs b sec 18circle c ranch tr 8c repcircle dcircle d, section 1circle d eastcircle d sec 4circle d sec 6circle j ranch lakesidecircle n ranch sec 1circle s ridge sec 01circuit of the americascisneros indust cnt #1cisterncistern 365citycity/austincity/austin div bcity/cuerocity/goliadcity/goliad range bcity/goliad range ccity/gonzalescity/hearnecity/new braunfelscity/round rockcity/san antonio ncb 1298city/san antonio sub 30city/taylorcity/waeldercity/yorktowncity blockcity block 4005city block 4029city block 4042city block 4051city block 4059city block 4066city block 5101city block 5102city by the seacity central centercity leon vlly ac nscity of boerne centralcity of bryan townsitecity of burtoncity of caldwellcity of carmine 360city of china groveeccity of fayetteville 390city of flatonia 400city of grangercity of grey forestcity of grey forest/bluehill nscity of jourdantoncity of la grangecity of la grange 425city of lubbockcity of lyonscity of round rockcity of schulenburgcity of schulenburg 497city of somersetsmcity of somervillecity of stockdalecity of taylorcity of thorndalecity only andersoncity only georgetown village sec 05 pudcity park-cameroncity scene apartmentscityside condos bldg 21city st. hedwig ac. (ec)city viewcity view estatescjo/f5c knutzen obstcla41claircrestclaircrest add sec 01clara vista at waterridge - brook collectionclara vista at waterridge - spring collectionclaremont pkwyclarence schicke 2clarence schicke 3claret crossingclaret xing sec iclark robert bclarks crossing 1clarks crossing sec 02clarks crossing sec 03clarkson 2ndclarksvilleclarks xing sec 01clarks xing sec 02classen ridgeclausens catch on lake lbjclawson 04 condominiumsclawson place condoclawson rdg condos bldg 5clawson rdg condos bldg 6clawson ridgeclay street homes condominiumsclayton addclayton josephclayton ranchclayton ranch ph 1clear coveclear creekclearcreek / maderaclear creek addclear creek estatesclear creek estates.clear creek estates ph fiveclear creek estates ph fourclear creek estates ph iclear creek estates ph threclear creek estates sec 3 ph 2clear crk duplexesclear crk ests ph 2 sec iiiclear crk ranch condosclearfield addclearforkclear fork estatesclear lake estatesclear lake pines - sec 1clear lake pines - sec 3clear lake pines - sec 4clear lake ranchesclear spgs ranchclear spring meadows unit 1clear springs parkclear springs prkclear springs ranchclearview estatesclearwater-eventideclearwater canyonclearwater canyon ranchclearwater creekclear water estatesclearwater estates 1clearwater harborclearwater landingclearwater landing at lbjclearwater ranchclearwater ranch ph 1clearwater ranch ph 2clearwater ranch ph 5clearwater ranch phase 5clearwater ranch ph fourclementine ranchclement lolitaclementson ranchclevelandclick acrescliff estates re-subdivisioncliff housecliff house bldg acliffs/lk belton ph iicliffs at cibolocliffs at lake belton ph icliffs austincliffsidecliffside condo amdcliffside second unitcliffs of canyon creek ph icliffs of canyon creek ph vcliffs of woodlakecliff viewcliftonclifton park elementary schoolclifton park first secclines landing condo-paclncloud countrycloud country 3cloud country subcloud country sub un#5cloud country sub un fiveclouds sub of blk 6, 7cloudwood ranch ph 1clover fieldcloverleafcloverleaf 40' patioclover ridgeclover ridge subclsclub at wells point ph a secclub heightscmcoachlight squarecoastal lanecoastal oaks add poccobalt canyoncobb's covecobblestonecochran c. surcoconut ranch sub tr 32cody addcody ganadocoffee addcoffee heights addcoffee heights add blk 2coffeevillecoffieldcoffield #1coffield #2coffield #3coffield #4cold spgs sec 01coldspringcold springscolecole & talleys fullview addcole estatescolemancoleto bend ranch estatescoleto bend westcoleto condominiumscoleto creek farms #2coleto lake estatescoleto lake estates ph 2colina cove, the legendscolina cove the legendscolina rv parkcolinas del lagocolina vistacolina vista condo amdcoliseum oakscollege courtcollege courtscollege guadalupecollege heightscollege heights addcollege heights add bl 3834college heights annexcollege parkcollege park twnhms ph icollege placecollege stationcollier j acollins gardenscollins subcollin william mcollinwood west sec ii-ccolonia alamedacolonial heightscolonial heights 1st extcolonial heights rep lts 3colonial hillscolonial hills sec 01colonial hills sec 02colonial hills sec 03colonial oakscolonial parkcolonial park amdcolonial park sec 1colonial park sec 3colonial park sec 4colonial park sec 5colonial park sec 6colonial park sec 8colonial park sec 9colonial park sec 10colonial placecolonial place amdcolonial trails sec 01colonies northcolonies villagecolony at cole springscolony creekcolony creek cc ph 1 rsb 2colony meadows sec 01colony meadows sec 02colony mud 1 f sec 2colony mud 1a ph a sec 3colony mud 1a ph b sec 3colony mud 1a sec 1colony mud 1a sec 1 ph bcolony mud 1a sec 3colony mud 1a sec i ph bcolony mud 1bcolony mud 1b sec 1colony mud 1b sec 2colony mud 1b sec 3colony mud 1b sec 4colony mud 1b sec 5colony mud 1c sec 1colony mud 1c sec 3colony mud 1c sec 4colony mud 1c sec 5colony mud 1c sec 6colony mud 1c sec 7colony mud 1e ph b sec 2colony mud 1f sec 2colony north sec 02colony north sec 03colony park hills iacolony park sec 01 ph 01colony park sec 01 ph 04-acolony ranchescolony riversidecolorado citycolorado crossingcolorado crossing 02 sec 01colorado crossing 03 sec 05colorado crossing iii sec 7colorado crossing iii sec 8colorado crossing iv sec 3colorado crossing iv sec 6-bcolorado east one-acolorado estatescolorado heightscolorado hills estatescolorado hills estates sec 02colorado hills estates sec 06colorado river ranchettescolorado river ranchettes unitcolorado shores ltdcolovista country clubcolovista estatescolovista estates section twocolovista townhomescolson ranchcolton bluff ph 3colton bluff ph icolumbia heightscolumbia oakscolumbia oaks amd 1981columbia oaks condocolumbuscolverleafcomalcomal country estates 2comal farmscomal hillscomal hills 1comal hills 1 extcomal hills 2comal tracecomanchecomanche addcomanche canyon ranchcomanche canyon ranch area 02comanche canyon ranch sec 01comanche canyon ranch sec 01/villa montanacomanche cliffscomanche covecomanche gap estatescomanche hillscomanche hills ranchcomanche hills ranch subdivisioncomanche land 1st unitcomanche mesacomanche pointcomanche point 02comanche point sec 03-a at point venturecomanche point sec 3-a at poincomanche point sec 3-a at point venturecomanche rancheriascomanche ridgecomanche trcomanche tracecomanche trail 02comanche trail 03comanche trail 03 resubcomanche trail estates sec 03comfortcomfort isd eastcomfort lotscomfort ltscomfort northcomfort outlotcommanche waterscommanders pointcommercecommerce s. to guadalupe (sa)commerce s to guadalupe sacommerce to mlk denver hts south of dignowitycommercialcommon land area - 47commons/rowe lane ph iv bcommons/rowe lane ph vi bcommons at avery ranch condocommons at rowecommons at rowe lanecommons at rowe lane ph 01 thecommons at rowe lane ph 02 acommons at rowe lane ph ii bcommons at rowe lane ph iv acommons at rowe lane ph v acommons at rowe lane ph viicommons at rowe lncommons at rowe ln ph 5bcommons lake houston - sec 4comm park 06 eighty 05comm park 1460community fairview sec 01community fairview sec 02community fairview sec 04complexcompton subcomstockconcanconcan country clubconcan country club at mountain valleyconcan oaksconcan oaks #1concan ranchconcan subdvsconcordconcord at brushy creekconcord village condo sonesta west sec 01a bconcourse at mueller condominiumsconder valley ph 9conder valley ph five amdconder valley ph fourconder valley ph oneconder valley ph threecondocondominium de saligny amdconey/cornish/ casperconey/cornish/casperconey/cornish/jasperconger n hcongress loftscongress lofts at st. elmocongress lofts condominiumscongress parkconnallyconnellconnell subconnelly's crossingconnellys crossingconnellys xing ph 4conners addconroeconstellationcontinental addconti propertycontrary creek ranchescontrasena ranch unrecordedconvenient courtsconverseconverse - old town jdconverse- old town jdconverse heightsconverse hillsconway add iiiconway add sec ivconway iicookcook & stewartcook add to cuerocooke h surcook gerald t sec 01cook o acoolcrestcool spgs ph 1cool spgs ph iicool spgs ph iiicool springscool springs phase iicool watercool water / sonterracool water acrescool water at sonterracoolwater at sonterracool water ph 1cool water ph 2cool water ph 3 sec 1cool water ph 4 sec 1cool water ph 5 secs 3 & 4cool water ranchcool waterscooper lane condocooper oaks sec 01-acooper villascooper villas condo bldg 600coors distributing subcopano caycopano covecopano ridgecopano villagecop hill est # 2cop hill est # 4cop hill est # 5coplins cove amd lts 4&5 blcopperas covecopperas cove 190 bus & icopperas cove heightscopperas cove heights 1st extcopperas cove heights 2nd extcopper branchcopper cancopper canyoncopper canyon-units 3copper canyon 1copper canyon 2copper creekcopper creek estatescopperfieldcopperfield 1st extcopperfield 2nd extcopperfield addcopperfield add rep lcopperfield meadows ofcopperfield sec 01 ph acopperfield sec 01 ph bcopperfield sec 01 ph ccopperfield sec 01 ph dcopperfield sec 01 ph ecopperfield sec 02-a amdcopperfield sec 02-b amdcopperfield sec 02-dcopperfield sec 03-acopperfield sec 03-bcopperfield sec 03-ccopperfield sec 03-dcopperfield sec 1 phs acopperfield sec 1 phs bcopperfield sec 2 a amendedcopperfield sec 2-a amended platcopper hill est #1copper hillscopper ridgecopper ridge addcopper ridge ph 2bcopper ridge ph 3acopper ridge ph 3bcopper ridge ph 4copper ridge ph 5copper ridge ph icopper ridge ph iiacopperstonecopperstone condominiumscopper stone mountaincopperstone mountaincoppertreecoppertree / heritage condo (ns)coppertree condo ph 02coppertree condo ph 03coppertree condo ph 04coppertree condo ph icoppertree condo ph vamendedcoral springscora stanleycorbin w pcordercordillera ranchcordillera ranch,the springs at cordillera ranchcordoba lodgecordovacordova bendcordova bend canyon lake 1cordova bend canyon lake 1rcordova crossing unit 1cordova crossing unit 2cordova estatescordova estates #2cordova trailcordova trailscordova trialscordova xing un 1cordova xing un 2corley farmscornelius crenshaw survcornelius lanecornelius lane surv 7 abs 482cornerstonecornerstone #3cornerstone condoscornerstones office condo amdcorner village at caballo ranch condocoronadocoronado - bexar countycoronado condoscoronado hills sec 01coronado hills sec 03coronado villagecoronado village jdcorpus christicorrilla county estacorsicanacortarocosper creek addcosper ridge estatescosper ridge estates ph twocostcosta bellacottage court condo amdcottage grove sec 04cottages/beaver crk ph 2cottages/meadowlake condoscottages/round rock town centrcottages at beaver creekcottages at beaver creek ph 1cottages at belterra villagescottages at crystal falls condocottages at deerbrookecottages at lake creek condocottages at meadowlake condocottages at parmer ranchcottages at round rockcottages at spillman ridge concottages at westfallcottages ave fcottages ave f northcottinghamcottle, sarahcottle g w lgcotton bottom estatescotton bottom estates phase 1cotton brookcotton commcotton crossingcotton crossing 6cotton crossing 7cotton crossing 8cotton crossing 9cotton gatewaycotton gin estates ph 1acottonwoodcottonwood condocottonwood condominiumscottonwood creekcottonwood creek condocottonwood creek ph 1 sec 1-bcottonwood creek ph 1 sec 1dcottonwood creek ph1 sec2cottonwood creek ph 1 sec 3cottonwood creek ph 3 unit 4cottonwood creek ph 3 unit 5cottonwood creek ph 3 unit 6cottonwood creek ph 3 unit 8cottonwood creek phase iicottonwood crk ph 4 un 1cottonwood crk ph icottonwood crk ph iicottonwood farmscottonwood mesacottonwood ph 2cottonwood shorescottonwood shores driftwood sectioncotullacotulla commercial 02couer du lac sec 03cougar ridge 1cougar ridge condoscougar ridge ph iicoulter heightscouncil creekcouncil creek southcouncil creek villagecouncil ridge condominia amdcouncil ridge condoscounsel j s lgcountry acrescountry air sec 01country bendcountry clubcountry club acrescountry club addcountry club estate rockdalecountry club estatescountry club estates #2country club estates #3country club estates, sec 9country club estates sec 04country club estates sec 05country club estates sec 07country club estates sec 08country club estates sec 09country club estates sec 7country club estates sec 7 amecountry club estates sec 8 amecountry club estates sec 9country club estates sec 9 amdcountry club gardens sec 03country club gardens sec 04country club gardens sec 06country club gardens sec 07country club heightscountry club terrace 2country club village icountry club village iicountry commonscountry corner subcountry estatescountry estates 02 ph 03country estates iiicountry estates ivcountry estates ph 1country estates sec 5country gardenscountry hillscountry hollowcountry land inccountry lane courtcountry line ranchettescountry manor estatescountry meadowscountry oak estatescountry oakscountry placecountry place #2countryplace sec 9country reservecountrysidecountryside addn-diebel addcountryside estatescountryside oakscountryside sec 01countryside village mhpcountry squire estatescountry terrace sec 01country trailscountry trails add 5th phcountry trails add 6th phcountry trails add 7th phcountry trails add 10th pcountry trails add 16th pcountry trails comm addcountry viewcountry view estatescountry view villagecountry villagecountry village estatescountry woodscounts estates ph two aka butler ranch estatescounty bl 4390/westpointe eastcounty bl 5474a windcrest un 2county club acrescounty glen sec 03county glen sec 08county linecounty line acreage eastcounty line estatescounty line ph ilcounty line subdivision phase iiicounty line sub phcounty viewcounty view addcouplandcoupland citycoupland estatescourseycourtlandt place iii-acourtyard at gaines ranchcourtyard at preserve condo tcourtyard at the preserve condominiums tcourtyard condo amdcourtyard hms/anderson oaks phcourtyard hms/cobblestone ph 9courtyard homes at anderson oaks condo ph 03courtyard homes at cobblestonecourtyard homes at cobblestone condo ph 05courtyard ph 02courtyard ph 06courtyard phs 6 thecourtyards at onion creek condocourtyards thecove at circle ccove condocoveney ranchcoventry crossing, sec. 1coventry crossing sec 01 amdcoventry crossing sec 02coventry placecove parkcovered bridgecovered bridge ph 1covered bridge ph 2covered bridge sec 06covered bridge whitecrowe subcoves at lakewaycoves of cimarron sec 2 ph 2coves of cimarron sec 2 ph 3coves of cimarron sec 2 ph 5coves on lake travis ph 1 seccoves on lake travis the ph 1covignton oakscovington oakscowboy crossingcowencoxcox 1st extensioncox 1st ext revcox addcox j acoyote ridge 2coyote runcr 450cr 452 acrescrabapple grove #2crabbcraft, john scraigcraig addcraigwood sec 02cranberry hillcranes mill landingcranes mill landing 1crawfordcrawford otcrawfords addcreedmoorcreedmoor add 01creek bend estatescreek bend sec 01creekbend sec 01creek bend sec 02creekbend sec 02creek bend sec 03-acreek bend sec 03acreek bend sec 04creek bend sec 05creek bend sec 06creek bend sec 3acreek bend south sec 01creek bus park sec 2creek cliff estcreek cliff estatecreek estates ph 2creek estates tr 2creekfallcreekhill northcreek meadows estatescreekmont westcreek of driftwoodcreek of driftwood half acrecreek place sec 2 amdcreekridge condocreek road ranchcreek road ranch sec 1creek road ranch sec 2creek road ranch sec 3creeks 3 ph vcreeks crossingcreeks edgecreeksidecreekside/georgetown village p u dcreekside/georgetown village pud pcreekside/georgetown village pudphcreekside/pioneer xing west cocreekside 02creekside addcreekside at camp verdecreekside at estanciacreekside at flint rockcreekside at georgetown villagecreekside at pioneer crossingcreekside at pioneer crossing westcreekside condominiumscreekside condoscreekside crossingcreekside crossing 1creekside crossing 2creekside crossing 3creekside crossing 5creekside estatescreekside estates sec 1creekside estates sec 3creekside farmscreekside farms sub un 3creekside farms sub un 4creekside glencreekside hillscreekside hills ph 4creekside hills phase 1creekside hills phs 2creekside hills phs 3creekside hills phs 4creekside homes condocreekside nscreekside park sec 3creekside park sec 5creekside ph icreekside ridgecreekside subdivisioncreekside terrace condocreekside villagecreekside village sec 3creekside village sec 4creekside villas townhomes - comalcreekside villas twnhmscreekside wellness centercreeks landing sec 1bcreekviewcreek view estatescreekview estatescreek view estates, sec 2creekview forestcreekview ph 01creekview ph 02creekwaycreekwoodcreekwood parkcreek wood ranchcreekwood ranchescreekwood ranchettes amdcreekwood subcrescent bluffcrescent bluff sec 1crescent bluff sec 4bcrescent bluff secs 2 & 3crescent hillscrescent hills ph 1 ncb 15248crescent hills swcrescent manorcrescent manor 1st extcrescent manor 1st ext repcrescent manor 2nd extcrescent manor 3rd extcrescent oakscrescent ridgecrescent ridge #1crescent valley #2crescent valley meadowscrescent view ph onecresta bellacresta bella enclavecrest haven additioncresthaven heightscresthaven necrest hills sec 01crestlakecrestlandcrestline at brushy creek - cypress collectioncrestline at brushy creek - juniper collectioncrestridgecrestviewcrestview 1stcrestview addn sec 7crestview add sec 01crestview add sec 03crestview add sec 04crestview add sec 05crestview add sec 07crestview add sec 08crestview add sec 10crestview add sec 12crestview amdcrestview heightscrestview sec 02crestview sec 2 resub of pt ofcrestview station resub of ltcrestview townhomescrestway heightscrestwoodcrestwood acrescrestwood acres (so)crestwood southcripple creekcripple creek duplexescrispcristabel court residencescr johns subcrkside farms sub un 3crkside farms sub un 4crockettcrockett heights sec 01crockett trace estatescroix condo amdcroix condo amendedcrooked creek ranchcrooked creek subcrosbycroslin courtcroslin court condoscross addcross add ph ivcross canyon ranch 1cross canyon ranch a-927 a-92cross creekcross creek acrescross creek phase 1cross creek ranchescross crk ranchcross crk ranch condoscross crk sub ph 2cross crk sub phs 3 & 4crosshousecrossing at bouldin creek thecrossing at carriage hillscrossing at carriage hills sec 09crossing at carriage hills sec 1crossing at carriage hills sec 2crossing at carriage hills sec 5crossing at carriage hills sec 6crossing at carriage hills sec 7crossing at carriage hills sec 9crossing at lookout canycrossing at onion creekcrossing at onion creek seccrossing at onion creek sec 01crossing at onion creek sec 03&4 amdcrossing at onion creek sec 05crossing at spring creekcrossing at two creekscrossing at wells branchcrossing at windcrestcrossing condo unit 302crossing condo unit 310crossing gardenhomes ii thecrossings/ havenwood un 3crossings at havenwood the 1crossings at havenwood the 2crossings at westlakescrossing spring creekthecrossing spring creekthe 2crossland estatescrossley addcross mountaincross mountain ranchcross plainscross reincrossroads #2cross s zavala countycross timber ranchcross timberscross timbers ranchcrosswindcrosswind, hidden hillscrosswindscrosswinds 50'crosswinds ph 3acrosswinds ph 5a/5bcrosswinds ph four-acrosswinds ph onecrosswinds ph twocrouellcrowleycrownhillcrownhill acrescrownhill parkcrown meadowscrown pointcrown ridgecrownridgecrown ridge 2crown ridge manorcrown ridge village sec 01crownwoodcrownwood jd/necrow ranchcrows sub resub lt 6& pt lt 7crow v tcrutchfield, johncrystal-trey addcrystal beachcrystalbrook sec 01crystal citycrystal crossingcrystal fallscrystal falls bluffs sec 3crystal falls commercial condocrystal falls condocrystal falls grand mesacrystal heightscrystal knoll terracecrystal knoll terrace pud uncrystal knoll terrace pud unit 01crystal knoll terrace un 02crystal knoll terrace un 04crystal knoll terrace unit 03crystal mountaincrystal mountain estatecrystal spgs condocrystal spgs ph 1crystal spgs ph 3 sec 1crystal springscrystal springs communitycrystal springs ph 1crystal xing ph 1cs-cliffcs-original towncs-orig towncs jollycsl com subctmfamhc ts subcuba john m sec 01cuba john m sec 02cuba john m sec 03 reinstatedcuellar susie & martin subdcuerocuero heightsculebra crossingculebra parkculebra s. to delgado (sa)culebra s. to delgado saculebra s to delgado sacullen ave condocullen country sec 1culling, aaronculpculp addcumberlandcummingscummings addn #3cunniff estatescunninghamcunningham, jamescunningham, john ccunningham j scupples/ zarzamoracupples/zarzamoracurrey creekcurry nichecurtis, washingtoncushing parkcut and shootcw bakerc w hahl & co subc w hudson sur 43c w lewis estatecypresscypress acres a-dcypress banks subdivisioncypress bendcypress bend on the guadalupecypress bend sec 01cypress bend sec 02 ph acypress bend sec 02 ph bcypress bend sec 03 resubcypress canyon sec 01-acypress canyon sec 01-bcypress canyon sec 02cypress canyon sec 04cypress canyon sec 2cypress canyon sec 3bcypress covecypress cove 1cypress cove 2cypress cove 3cypress cove 4cypress cove 5cypress cove 6cypress cove comalcypress cove section 1cypress creekcypress creek 2cypress creek acrescypress creek condocypress creek northcypress creek sec 04cypress creek townhomescypress creek twnhmscypress creek volentecypressdalecypress fairway village 1cypress fallscypress forestcypress forest 6 creeks hometowncypress forest ph 3 sec bcypress forest ph four sec acypress forest ph onecypress forest ph twocypress forest six creeks 6 creekscypress hollowcypress lake gardenscypress lake gardens/longhorncypress lake gardens western skiescypress lake grdns/big sky rnhtscypress lake grdns/golf rangecypress lake grdns/high countrycypress lake grdns/western skiescypress millcypress mill 01 sec 02cypress mill 01 sec 04cypress mill 01 sec 05cypress mill i sec 2cypress pointcypress point sec 1cypress point sec 1acypress point sec 2cypress rapidscypress rapids gruene 3cypress rapids gruene 8cypress shorescypress sprgs the guadalupe 4cypress springscypress springs estatescypress springs on the guadalupecypress trail loopcypress trailscypress vlycypress vly re - subcypress vly re-subcyprus pointecystal springsd & j propertiesd & w railroad company surv #1d & w railroad co survey no. 105 abs 249d.a,thompson surveyd. davisd5005d a chamberlain adddahlberg estates sec 3dahlberg estates sec 6dahlia estates ph 4dairy acresdaledallasdalrympledalworth parkdalyndivisiondancing beardancing bear ranchdancy adddaniel c hoover surv 322 abs 2daniel downes surveydaniel monroedaniels 2nd adddaniels mountaindaniels mountain ph 1daniels mountain ph idaniel subdaniel walker league a 334dan jean oaksdan mckie add 1dan mckie iidannelleyd a parrisdarlingtondauer ranchdauer ranch estatesdaugherty surveydavenport acresdavenport ranchdavenport ranch ph 01 sec 03davenport ranch ph 02 sec 01davenport ranch ph 05 sec 01davenport ranch ph 07 sec 02davenport ranch ph 07 sec 03davenport rim condo amddavern betty ldaves subdavid burkettdavid curry 3/4 league surv trdavid estatesdavid harmondavid houston surv abs #185david miller surv #88davidsdavidsondavidson ranchdavidson r tdavila, m. surdavila grangerdavilla, migueldavisdavis adddavis ddavis hill estates sec 01davis h tdavis ranchdavis ranch un 1davis spgs sec 05-adavis springdavis spring sec 03-adavis spring sec 03-bdavis spring sec 03-cdavis spring sec 03-d amddavis spring sec 05-adavis spring sec 3-d amendeddavis t m acrdavis w edawn view acresdawsondawson ranch ph ii secdawson ranch ph i sec idawson ranch ph vdawson ranch sec i ph idawson ridge adddawsons crossingday land & cattle co a-477dayspring christian fellowshipdaytonday william edb subd d carroll surv abs #1214deandean 2de ann subde ann sub rep of ldean terracedeatonhill condo amddechertdecker creek estates sec 03decker creek estates sec 04decker idecrow, thomasdeef havendeep acres est 2 - comaldeep eddy heightsdeep hollowdeep river - sec 2deerbrookedeerbrooke ph 1deerbrooke ph 2 sec 4deerbrooke ph 2 sec 5deerbrooke ph 2 sec 6deerbrooke ph 2 sec 7deerbrook villagedeerbrook village anderson milldeer canyondeer canyons ranchdeer creekdeer creek estatesdeer creek ranchdeer creek ranch - twin lake hillsdeer crestdeer crest un 1deer crest un 2deer crest un 3deer crest un 4deer crk subdeerfielddeerfield estatesdeerfield estates ph fourdeerfield estates ph onedeerfield estates ph threedeerfield estates sec twodeerfield gdn homesdeerfield parkdeer field place at woodcreekdeer flat addn iideer forestdeer grovedeer grove estatesdeer grove subdeer grvdeer grv subdeer havendeer haven subdeer hillsdeer hollowdeer hollow unrec subdeer lakedeer lake estatesdeer meadow estatesdeer meadowsdeer meadows ph 1deer meadows ph 3deer meadows ph 4, lots 223 & 224deer meadows ph 5adeer oaks subdeer parkdeer park at maple run sec 10deer park sec 02deer park sec 03deer park sec 05deer ridge estatesdeer riverdeer river ph 1deer river ph 3deer rundeer run estatesdeer run phase onedeer spgsdeer springs subdivisiondeer valley estatedeerwooddeerwood circledeerwood estatesdeerwood estates sec 2 pocdeerwood lakes 6deets e h et al estatedegraffenrieddelaware creekdelaware spgsdelaware springsdel caballodel caballo un 1del cabello un 1del curtodel curto condodel curto placede leondelgado s. to w. martin (sa)delgado s. to w. martin sadelgado s to west martin sadella oasisdell citydellcrestdellcrest parkdell oak estatesdellrose sec 10dellviewdell view st ncb 10540 un 7deloya subdivisiondel riodelta acresdel valledelvalle sdelvalle s acrdel webb lost pines at the colonydel webb veramendidelwood 04 east sec 02delwood 04 east sec 03delwood 04 east sec 04delwood 04 sec bdelwood 4 east sec 3delwood heightsdelwood secdelwood sec 01delwood sec 02delwood sec 03delwood sec 04delwood terrace sec 01delzelldelzell sec 02denizen condo amddenizen condosdenman twin mountainsdenman twin mountains 2nddenson, a jdentondenver heightsdenver heights east of new braunfelsdenver heights west of new braunfelsdenver hightsdeorsam estates ph onede penadepot & bottom adddepot townhomesdesert willow acresdesert willow comm subdidesideratadessau bus park sec 2dessau estates sec 03destiny hills sec 2development tractdevil's backbone heightsdevils backbone heightsdevinedevine hillsdevine isd in towndevine lakedevine lake ph 1devine lake ph 2devine lake ph 4devine lk ph 1devine oaksdevine peanut farmdevonshiredevonshire park sec 03dewberry ridgedewitt sarahdewitty acresde zavala trailsdezavala trailsd g flores surdhanisd h buchanan addd h buchanan add second sdiamond acresdiamond backdiamond crossdiamondhead condo nsdiamond head condos ph 2 bldgdiamond hills additiondiamond j ranchdiamond oaksdiamond ridgediana adddibrell sub repdicey hopkins surv abs #300dickinsondicksondickson 01dickson 02 tr 01dicy hopkins surv # 11 abs 356diengerdienger additiondietertdignowitydignowity hilldignowity hill hist distdignowity hill historic districtdijon north condo ahdilleydilley cb4dilley cb 54dilley cb54dime boxdime box area 1-6-1d6dimmit adddittmar/ slaughterdittmar a b 02dittmar crossingdiv b pannell placediv d grahamdivisiondivision-w.-nogalitosdivision 0 202division adivision a harts adddivision bdivision cdivision ddivision edivision e. of ih35division e of ih35division odivision w.-nogalitosdivision zdixie hair sub sodixie terraced jd j smith tx rice dev subd love surv abs #212d l richardsondm mcferren minor subd monroe s a & a pdoak adddoak additiondoaks adddockal ranchettesdockal ranchettes ph 2doehne oaksdogwooddogwood additiondogwood lakedollhouse ranchdolphin landing sub pocdomain sec 2 sub resub of ltdomain south enddominiondominion/new gardensdominion/the bluffs atdominion/the reservedominion condodominion enclavedominion heightsdominions weslacodonald hanksdonaldson terracedonall estatesdonegandonnell parkedonnell parke condominium homesdonnell parke condos bldg 7donnell parke condos bldg 19donore placedonore squaredoraldoral iidorner add tr 2dorothy leadorsett oaksdos bahia pocdos lagos subdos rios at chimney oaksdossdoty river estatesdoube eagle ranch iidouble c countrydouble creek crossingdouble creek office condodouble eagledouble eagle ranchdouble eagle ranch, sec 2double eagle ranch ph b sec 3double eagle ranch sec 1double eagle ranch sec 4double gate ranchdouble horndouble horn creekdouble ott ranchdouble u tx subdoughty & mathisdouglas estatesdouglassvilledouthit coulterdove canyondove city subdivisiondove country farmsdove creekdove creek sec 01dove creek sec 02dove crossingdove heightsdove hill estates sec iiidove hollowdove landingdove landing subdivisiondove meadowdove meadowsdove milldoverdover heightsdoves landingdoves landing iiidove songdove spgs ph 03dove spgs sec 02 ph 02dove springsdove springs sec idove trailsdove valley estatesdowell johndowney & johnson adddowney caney creeekdowney caney creek sec 12downey caney creek sec 15downey caney creek sec 16downing lane industrial parkdowntowndowntown goliaddowntown highrise condosdowntown historic districtdowntown round rockdowntown victoriadoyle, jamesdoyle jamesd p hopkinsd p hopkins #1d p hopkins iidrake jamesdrakes crossingdrakes landing phase iidrakes lndg ph 2 amending platdrakes lndg ph iidrakes lndg ph onedraper acresdrapers estatedrapers estatesdraw/rock rdg subdraw at rock ridged r castleberrydream hill estatesdreamland oaksdreamwrightdresden wooddrew lanedrew lane condodriftwooddriftwood/cottonwooddriftwood/cottonwood shoresdriftwood bus center condodriftwood business centerdriftwood estatesdriftwood falls estatesdriftwood shoresdriftwood shores at wolf pointdriftwood vistadripping spgsdripping spgs heightsdripping sprgsdripping springsdripping springs heightsdripping springs ranchdriving park adddriving park addn 1910d robison adddromgoole, thomasdrumgoole, thomasdry creek west condodrydendryden addn revisedd s combs adddtdubose add blks 1-7dubose add ext blkduck havenduffanduffyduffys adddugger subdulaney estatesdumasdunbar estatesdunbarton oaksduncan & coduncan farms ph idunk subdunlap subdivision/sabinaldunliegh add sec 02dunndunn adddunn estatesdunn snyder & mooarduquetteduran adddurangodurango/rooseveltdurango farmsdurango farms ph 1durango farms ph 2durango ph 1adurango ph 1a finaldure len cdurham park sec 2durst ranchdurst ranch 4dusondustin river ranchesdustin river ranches iidusty rose ranch westdutch myrtle townhomesduty, solomonduty surveyduval spgsduval villasduval villas 02dw lightdyerdykesdykes, dennisdykes sur.e & be. brewer surveye. cesar chaveze. commerse est (ec)e. houston so. to hedgese. houston so. to hedges(sa)eagle cave vieweagle creekeagle creek estateseagle creek ph ieagle creek rancheagle ford shale crossingeagle heightseagle lakeeagle landingeagle oaks at the lake ph ieagle passeaglepoint subeagle rancheagle ridge sec 02 amdeagle ridge sec 04 amdeagle ridge sec 05eagle ridge sec 11beagle ridge sec 13eagle ridge sec 14 ph 01eagle ridge sec 14 ph 03 amdeagle ridge sec 14 ph 04eagle ridge sec 14 ph 05eagle ridge sec 14 ph 3 (lts 4-14 beagle rock heightseagle rock rancheagle rock ranchitos sec 1eagle rock ranchitos sec 3eagles bendeagles bluffeagles cresteagles landingeagles landing ph 01eagles lndg ph 2eagles nesteagles nest subeagles peak rancheagles peak ranch 1eagles peak ranch 2eagle springs ranch iieaglestoneagle valley ph iieagle view placeearlyeasleyeasley properties subeasley properties subdeast 2nd condoseast 31st streeteast 52 street 924east austineast aveeastburn acreseast centraleast central areaeast commerce estateseast elms killeen addeast end flats amdeastern heights sec 01eastern wellseastern wells ph 2eastern wells ph ieasterrain subeast farmeastfieldeastfield addeastgateeastgate condominiumseastgate condominiumseast groveeast grove condominiumseasthilleasthill subeast houston est.east houston estateseastlakeeastlake residenceseastland, nicholas weastland, wm meastland 2ndeastland 2nd add reveastland terr/boerneeastlawneastline condoseast lynn addeast main additioneast mlkeast new braunfels addeast of gartheaston parkeaston park - nelson villageeaston park- nelson villageeaston park ph 1 sec 3aeaston park ph 2 sec 2beaston park residential condoseaston park seceaston park sec 1aeaston park sec 1ceaston pk ph 1 sec 3aeastovereast parkeeast quarryeast ridgeeastridge park - northeast rivercrest add sec 2east riverside - oltorfeast round rockeast seidel hills bl 11853east shearer hilleast shearer hillseast shoreeast shore condoseast sideeastsideeastside addeast side annexeast terrell heights (ne)east terrell hillseast terrell hills heightseast terrell hills neeast travis hillseastune condoseast university placeeast university place condominiumseast university place condoseast uvaldeeastview addn part 2east view farmseast view rancheastview terraceeast villageeastvillageeast village condoeast village condo amdeast village condo theeast village jd/neeastvillage single family ph 4eastvillage single family ph veast village sub un 46-ceast whitson additioneastwoodeastwood/riverside ii condoseastwood at riversideeastwood at sonterraeastwood sec 2eastwood sec 4eastwood sec 6eastwood sec 7eastwood subd.eastwood villageeat farmeatoneben hagen surv a-58e b hargraves surveblin 426eblin je brewer surv abs #61ebt farme cantu #1810 a0006echo canyonecho creekecho village ph iecho village ph twoecho vista addecho vista add ph twoeckel 428eckhert condominiumseckhert crossingeckhert placeeck laneeck lane addeck l tecleto creek ranchettes sube curd & j c rogerseddyedelmon estsedeneden/seven oakseden acres 02eden crossingeden crossing / wilsoneden farms sec #2eden rancheden ranch 1eden ranch 2eden ranch 4eden ranch 5eden ranch 7eden rocedgar b davisedgar m bounds kuykendall mounedgebrookedgebrookeedgebrooke / howard laneedgebrooke / howard lane ph 2edge cliffedgecliff condo nsedgecliff nw condo amdedgecliff nw condominiums amendededgecreek condo amdedgecreek condosedgefieldedgefield addedgemontedgewateredgewater beach sec 01edgewater beach sec 02edgewater condosedgewater estatesedgewater hickston subdivisionedgewater sec 02edgewickedgewick condoedgewick condominiumsedgewick condosedgewoodedgewood area 10 (ed)edgewood estatesedinburgedinburgh gardensedinburgh gardens sec 02ednaedward grittenedward gritten leagueedward gritten surv abs #13edward joseph subedward norton surv #760edwards, charlesedwards bus parkedwards g wedwards subdivisionedye myrte e nettles adde e nettles resub of pe georgetown isd abstracteggerseggers southview addeggleston goldbeck & seeling seggleston svreglestone gortarie gtown isd abstractsegypte houston so to hedges sae houston so to hedgessaeichelbergers ruby sub am lteichman place subdivsioneidman addeidman addneight hundred banister placeeilers add 526e joneselel camino realel camino real estatesel camino real ph 01 sec 02el camino real ph 1 sec 1el camino real ph 1 sec 2el camino real ph 1 sec 3ael camino real ph 2 sec 1el camino real ph 2 sec 3el campoel chaparralel chapparaleldoradoel doradoeldorado at santa rita rancheldorado at thousdand oaks iiiel dorado heightsel dorado heights 1el dorado heights 3el dorado hillsel dorado neel dorado subeldridge teleanor condominiumse leichtle surv abs #382 & 524eleventh st addelginelgin cityelgin city 002elgin city 003elgin meadowselgin oaks twoelgin rolling meadowselgin ruralelijah d harmon surv abs # 6elijah d harmon surv abs #6elijah tateel indioelisha championelisha vie surv abs #470elisonelizabeth place townhome subdelkhart condominiumselkhorn ridgeelk mountainelk mountain ranchelk mountain ranch 1elk mountain ranch creekellett estateselleyelley laneelley lane subdivisionelley lane sub un 2elley west un 1elley west un 2elley west un 3ellingerelliott add ph oneelliott ranchelliott ranch ph 04elliott ranch ph threeellisellis highlineellis highline condominiumellis highline condosellis ranchelly crossingelm arbor ranchetteselm branch estateselm creekelm creek estateselm creek northelm creek north phs 1elm creek ranchelm creek ranch estateselm creek sec 01elm creek sec 02elm creek sec 03elm creek sec 04elm creek sec 5belm creek southelm crk north ph iiielm crk north ph ivelm crk northwest ph 1elmendorfelmendorf area ecelmendorf estateselm grove campelm grove estateselm grove sec oneelm grove section 3elm grove section threeelm grove section three-belm grove sec twoelm hill sec 2elmhurstelmhurst amd of lts 5&6elmhurst heights sec 03elm parkelm ridgeelm ridge estates coelms condoelm shoreselm springselm springs ranchelms run add ph oneelms run comm westelm trailselm trails subelm valleyelm valley parkelmwoodelmwood estateseloise estates subel pasoel senderoel sendero at westlael sendero luminosoel toroeluah d harmond surv abs 6elzy harrison surv abs #379e mabry surv a-362e main stembassy manor town-houseembreeemerald bayemerald bendemerald bend sec 01emerald bend sec 1emerald forestemerald forest gardeemerald forest sec 01emerald forest sec 03emerald forest sec 04emerald forest sec 05emerald forest sec 5emerald hillemerald hill resubd no1emerald oaksemerald placeemerald pointemerald pointeemeraldsemerald townesemerald valleyem franklin 2nd resubemma frey area edemmanuel havenemory crossingemory crossing 40'semory crossing 50'semory farmsemory farms sec 01emory farms sec 4emory farms sec 6empressarioenchanted bluffenchanted forestenchanted harborenchanted oaksenchanted oaks 1stenchanted oaks parkenchanted oaks sec 2 replaenchanted ranchenchanted river estatesenchanted river estates 2enchanted valleyenchanted villageenchanted village twnhses bl 13931encinalencinal condoencinitasencinoencino acresencino bluffencino creekencino crossingencino forestencino hillsencino mesaencino parkencino park terraces at neencino park village at neencino ridgeencino rioencino villageenclaveenclave/brushy crk sec 01enclave/brushy crk sec 03enclave/bulverde crk bl 34920enclave/cele sec 2enclave/hidden oaksenclave/lagos condosenclave/maya vistaenclave/town center ph 02enclave/troyenclave at alta vistaenclave at alta vista amdenclave at brushy creekenclave at brushy creek sec 01enclave at brushy creek sec 02enclave at brushy creek sec 03enclave at bulverde creeenclave at canyon lakeenclave at canyon springsenclave at celeenclave at chandler creekenclave at commanders point amenclave at elm creekenclave at esconderaenclave at estanciaenclave at estancia condominiuenclave at estancia condominiumenclave at estancia condominiumsenclave at hidden oaksenclave at horizon pointeenclave at kollmeyer springsenclave at lagosenclave at lagos condominiumsenclave at laurel canyonenclave at maya vistaenclave at mesa sec 01enclave at northeast crossingenclave at sarah's creek condominiumsenclave at sierra vistaenclave at sonoma ranchenclave at sutherlinenclave at the legendsenclave at town centre ph 01enclave at town centre ph 02enclave at vineyardenclave at westgateenclave at westover hillsenclave at westpointe villageenclave at willow pointeenclave at yauponenclave canyon lake the 1enclave canyon lake the 3enclave of garden ridgeenclave of potranco oaksenclave of rustic oaksenclave of silver oaksenclave villas condoenclave westpointe village 1encore at drew laneends on 06enfield 10enfield aenfield cenfield challenge condoenfield denfield fenfield henfield h south extenfield twnhmsenfield west 02 condo amdenglishenglish hollowenglish jenglish oaksenoch acresenoch brookse nortonensenada shoresensenada shores @ canyon lake 4ensenada shores at canyon lakeensenada shores at canyon lake 2ensenada shores canyon lake 1ensenada shores canyon lake 2entrada ph 3entrada ph 4 a small lt subentrada ph 5entrance at lakewayep austin properties sube pettus surv abs #231ephraim brownep pulliam surv abs # 676ep residential condoserasmus brewer surv abs 61erastus wright surv #1116 abserath, georgeerath, george b.erinerins glenerskine ferryesancia westescalaescala/san gabriel condosescala at 34th condoescala at san gabriel condoescalera ranchescalera ranch 1833escalera ranch 1833-ph 3escalera ranch pud sec 02 repescalera ranch sec 05 pudescalera subdivision pudescape condoescondera condo amdescondera condo bldg 3escondera condominiumescondera condominiumsescondida at sunsetescondida ranchescondidoescondido/parc atescondido creekescondido creek sub ut-3escondido golf and lake clubescondido meadowsescondido northescondido parkescorial condoesnaurizar a mespadaespada tractespantosaesparza svyesperanzaesperanza - 70'esperanza - 80' and 90'esperanza - kendall countyesperanza sub ph 2esperanzeespinado del diabloespinazo del diabloespiritu santo bay residenceespiritu santo bay resortesquel ph 1 sec 4estanciaestancia hill country sub ph 3estancia ranchestancia westestate of kensington ranchestate of windy hillestatesestates/northgate ph 1 sec 1estates above fall creekestates above lost creekestates at arrowheadestates at champions runestates at edgewater beachestates at grandview hillsestates at hunters chase sec 01estates at mitchell ranchestates at mountain spgs raestates at mountain springs ranch theestates at northgateestates at oatmealestates at panther creekestates at rancho del lagoestates at riata oaksestates at round mountainestates at settlers parkestates at settlers park sec 2estates at settlers park sec 3estates at settlers park sec 4estates at stone crossingestates at stone crossing phasestates at stonewall ranchestates at wilbarger creekestates at wilbarger creek secestates at zaccaria ranchestates carpers creekestates carpers creek 2estates lakeway hills sec 01estates lakeway hills sec 03estates lewis mountainestates north creek ranchestates north creek ranch sec 01estates north creek ranch sec 03estates of alonestates of brentwoodestates of colony creekestates of flintrock theestates of kensington ranchestates of north creek ranch sec 02estates of northgateestates of point aquariusestates of quail runestates of walburgestates of waycrossestates of westlake ph 3bestates of westoverestates on stratford mountainestates on the riverestates rancho del lago 6estates rowe lane sec 01estates rowe lane sec 02estates subdivisioneste; condominiumeste condoeste condominiumesther berryestoniaeston parkestrada country hill estatesestrada heightsestrellaestrella on rittimanestrella xingeubank acres sec 01eubank acres sec 02eubank acres sec 03eubank acres sec 03aeubank acres sec 1eubank acres sec 2eubank addeurekaevans, musgroveevans cornerevans ranchevans ranch neevans t zevantevelynevening hollow 1st extevening hollow 2nd extevening hollow 3rd extevening hollow 3rd ext revening hollow 4th extevening hollow 4th ext aevening hollow addevergreen courtsevergreen ph ievergreen sub ph ivevergreen sub ph vevergreen viewpointeevergreen villageevergreen village 1evergreen village 2evergreen village 3everly estateseverman westevertsonevolv eastevolv east condominiumse whittlesey a 362exemptexeter house condo nsexotic acreseyerly m jf & s addf001d30f - florence / burnet isd ruralfa hudson surv abs #295fain add ph 2fairfair-fair - northfaires add 402fairey oaks sec 2fairfieldfairfield manorfairfield villagefair grounds addfairhavenfairhaven 40'sfairlane acresfairlawnfairlawn addfairmeadefairmont park sec 01fair oaks-golffair oaks golffair oaks ranchfair oaks ranch un afair to southcrossfairviewfairview add #3fairview addn #2fairview addn #3fairview commons condo amdfairview heightsfairview parkfairview ranchfairview subfairway bridgefairway crossingfairway heightsfairway park 1st unitfairway park 1st unit repfairway park 2nd unitfairway place sec 01fairway ridgefairwaysfairways/crystal falls ph 2b sfairways/crystal falls ph 5 sefairways/crystal falls sec 2 pfairways/woodlake sub pud un 1fairways at canyon lakefairways at crystal fallsfairways at crystal falls, cap rockfairways at crystal falls sc3 pfairways at crystal falls secfairways at crystal flls sc3 pfairways at river crossingfairways at scenic hillsfairways at steiner ranchfairways blackhawk ph 03-afairways blackhawk ph 04fairways blackhawk ph 1-afairways of blackhawk ph 5afairways of sonterrafairways of woodlakefairways on fazio at barton creekfairways on fazio at barton creek cofairways on the faziofairways ph 01 crystal falls 02 thefairways ph 1 crystal fallsfairways phs 1 crystal fallsfairways scenic hills #2 gcfairways scenic hills 2fairway street condofalcon-woodfalcon crestfalconheadfalconhead spillman ranchfalconhead west ph 01 sec 01falconhead west ph 1 sec 2 &falcon heightsfalcon landingfalcon landing ut-1 bslfalcon pointefalcon pointe blvd extensfalcon pointe condominiumsfalcon pointe sec 01falcon pointe sec 02falcon pointe sec 03falcon pointe sec 07falcon pointe sec 4-north ph 02falcon pointe sec 4-southfalcon pointe sec 5bfalcon pointe sec 6-bfalcon pointe sec 6afalcon pointe sec 8bfalcon pointe sec 9-south phfalcon pointe sec 9-westfalcon pointe sec 12falcon pointe sec 13 ph cfalcon pointe sec 14 ph 1falcon pointe sec 14 ph 2falcon pointe sec 16falcon ridgefalcon ridge unit #2falcon woodfalconwoodfalfurriasfallbrookfallbrook - bexar countyfall creekfall creek ranchfalling waterfalls cityfalls martindale thefalls of san gabrielfalls san gabrielfalls sec iifamilyfamily acres sec 1family living estatesfamily treefannie a d darden survfanninfannin oaksfannin place subfar hills ranchfarishfarleyfarley, m. surfarmfarm & ranchfarm additionfarmers at western oaksfarmers home addfarmington commonsfarmington commons condofarm lotfarm ltfarrell lane flex space condofarrisfarris ranch eastfarris ranch sec 02far west skyline condofaucett comm subfaucett comm subdvisionfaulk henryfauriefaurie 3faurie rdfawn ridgefawn ridge sec 01fawn ridge sec 02fawn ridge sec 02 (east travis heights)fawn runfawn valley estatesfawn valley rep blks 1-2fayette county school land surfayette school land surv a-182fayette shores covefayettevillefb earnest league abs 19fb fosterfb foster subfbg addfbg additionfbg zenner-ahrensfcf c s lfeathergrassfeather ridgefeder estatesfedor estatesfedor estates sec 3feild ranchfelix chenaultfelix sanchez surv abs34fellersfellman heightsfeltner addf elua surfentressfentress airpark communityferguson estatesfern bluff sec 01-afern bluff sec 02fern bluff sec 02 amdfern bluff sec 03afernwood forestfertile valleyff & gt addf flores surf hernandezf herrera surfield, hfield creek estates ph 2fielder additionfield housefield h surfiesta apts 01fiesta apts 02fifth & westfifth & west residencesfifth & west residences condofifty one eastfinal plat/colony mud 1a sec 3final plat/navarro sub un 1cfinal plat/northforkfinal plat/pecan parkfinal plat/pecan park sec 1bfinal plat/rho sienna ph 2 secfinal plat stone vly ph onefinesilverfinlay r kfireflyfirefly corpus christi rv and tiny homesfirefly fredericksburgfirefly pointefirefly pointe ph 1firefly resortfirefly rv & tiny home condofirefly rv & tiny home condominium communityfirefly rv & tiny home condo pfirefly rv & tiny home condo poafirefly rv & tiny home condo unrec a52firefly rv & tiny home resortfirefly rv & tiny homesfirefly rv and tiny home condofirefly rv and tiny home condominium communityfirefly rv and tiny home resortfirehouse business centerfirst mountainfirst mountain 1fischerfischer (comal)fischer gardensfischer subdivisionfischer tr un 3c-1fischer un 1bfiset placefisherfisher & millerfisher comm subfisher ranch ph 01fisk gfiskville school addfitzgerald addfitzhughfitzhugh bus center prop owners assocfitzhugh cornersfitzhugh parkfitzhugh park condofitzhugh park condominiumfitzhugh placefitzhugh trailsfive & one addfive fifty 05 condo amdfive hundred 05 bellevue place condofive oaksfive pointsfive points beacon hillsflagstone ranchesflagstone terrace condoflagstone terrace condo ph 01flagstone terrace condo ph 02flamingo condoflanders heights revflat creekflat creek estatesflat creek ranchflat creek ranchesflat creek reserveflatoniaflatrock acresflatrocks villageflats/935 condosflats/935 condos bldg 1flats/935 condos bldg 2flats/935 condos bldg 3flats/935 condos bldg 4flats 935 condos bldg 5flats at 935 condosflats on wilsonflats on wilson condo afleetwoodfleetwood iifleetwood ivfleetwood iv ph iiifleetwood sub resubd 1fleischerflemingfletcher iiflint ridgeflint ridge estatesflint ridge estates 5flintrockflintrock at hurst creekflintrock at hurst creek ph 01flintrock at hurst creek ph 02flintrock at hurst creek ph 03flintrock at hurst creek ph 04flintrock at hurst creek ph 07flintrock subflite acres little ranchesflite acres sec 1f lopezfloraflora meadowsflorenceflorence cityflorence city lts 1213 & 15 blk p resub blkflorence ruralflores joseflores oaksflores parkflores park subfloresvillefloresville green acresfloresville old townfloresville ruralfloresville rural impsfloresville sectionsflorine terraceflournoy & jones 04 sec 01flournoy's eastern hills sec 4flournoy hts sec 3flournoys eastern hillsflournoys eastern hills sec 04flournoys sweetbriar sec 02flournoys sweetbriar sec 03flournoys sweetbriar sec 04flournoys sweetbriar sec 08flournoys sweetbriar sec 09flournoys sweetbriar sec 10flournoys sweetbriar sec 11flower hillflower hill estatesfloyd acresflsvruralflsv rural rv 9flying l ranchflying r ranchflying t ranchfm 609 annexfm 969 ranchettesfm 1556f m 2615 acres sub 2fm3349foothillsfoothills barton creekfoothills ranch estates phaseford additionford oaksford oaks annexford placeford place #1ford place 2forest addforest bend twnhsforest bluffforest bluff sec 01cforest bluff sec 02forest bluff sec 03forest bluff sec 04forest bluff sec 05forest bluff sec 6forestburgforest creekforest creek ph 01 sec 01forest creek ph 01 sec 03forest creek ph 05forest creek ph 1 sec 1forest creek sec 07forest creek sec 8forest creek sec 10forest creek sec 12forest creek sec 14forest creek sec 16forest creek sec 17forest creek sec 18forest creek sec 21forest creek sec 27forest creek sec 28forest creek sec 31forest creek sec 33forest creek sec 34forest creek sec 35forest creek sec 36forest creek sec 38forest creek subdivisionforest crestforest crk ph 01 sec 02forest crk sec 08forest crk sec 09forest crk sec 11forest crk sec 18forest crk sec 37forest hillforest hillsforest hills 1st extforest hills a addforest hills estates part iiforest hills resubforest hills sub sec iiiforest lakesforest meadows nsforest mesaforest mesa/villa serenaforest north estatesforest north estates ph 2forest north estates ph 4forest oakforest oak ranches phase 2forest oaksforest oaks 1forest oaks 6forest oaks n.e.forest oaks sec 02forest oaks sec 03forest oaks sec 1forest oaks sec 1 pudforest oaks sec 2forest oaks sec 3 pudforest oaks sec 6forest oaks sec 7forest oaks sec 10forest oaks sec 12forest of garden rforest of garden ridgeforest parkforest rdg ph 7bforest ridgeforest ridge estatesforest ridge ph 02forest ridge ph 04forest ridge ph 05forest sec 2 at the villages oforest view northforest view north, unit 1forest view north unit 1forest watersforest wood addforest woodsforest woods unit 4forest woods unit iiforister ranchforkforrest hill ph iforrest hill ph iiforrest hill ph iiiforshagefort clarkfort clark springsfortdavisfort dessaufort dessau ph 2fort dessau townhome condosfort dessau townhomesfort dessau townhomes/condofort dessau villasfort mckavettfort stanley creekfort stocktonfortunafortune estates sec 02fortune estates sec 04 resubfort view hills sec 01fort worthforum creek jdforwoodfossil ridgefossil springsfossil springs ranchfosterfoster acresfoster a rfoster meadowsfoster placefosters branchfounders ridgefounders ridge sec 1founders ridge sec 2afounders ridge sec 3founders ridge sec 4fountain parkfountain park southfountainsfountainwood estatesfountainwood estates ph 2four-t ranch sec 01four coorners goforthfour oaks subfour pointsfour points landing northfour seasons fall secfour seasons farmfour seasons farm ph 1 sec 1four seasons farm phase 1 sec 1four seasons farm sec iifour seasons lake austin private residencesfour seasons summer secfourteenth fairway condofourth&fourth & condosfourth and condominiumsfourth minor amd plat/jarrellfour x ranchfowler addfowlertonfoxbrookfox creekfox creek comm ph foufox creek subfox creek sub ph onefox creek sub ph one replafox creek sub ph sixfox creek sub ph threefox creek sub ph viifox fallsfoxfieldfox grovefox hollow condofox hollow condo amdfox pocfox ridge ph 1fox runfox run estatesfox tail estatesfoxx fire meadow add amdfraim addframe switchfrancis a hudson surv abs #295francis bradley surveyfrancis g keller surv abs #37francitasfrancitas landsfrank condominiumsfranklinfranklin estatesfranklin park amdfranklin park amendedfranklin squarefranklin square bishops crossingfrank padilla & sons subfrank realfrank real subdivisionfranksfrank westfrank y smith subfrazier addfrederich dahme surv 43 abs 22fredericksburgfredericksburg road acresfredericksburg road acres 02fredoniafredricksonfred woodfree & williamsfreedomfreedom hillsfreedom parkfreedom ranchfreedom spgs ranchfreedom springs ranchfreedom valleyfreedom villagefreelove woodyfreelove woody surv abs 20freelove woody surveyfreemanfreeman george league a-224freeman heightsfreeman park ph 3freeman ranch sec 3freeportfreerfreewater addfreeway manorfrench, samuelfrench creek villagefrench quarter on lake conroefrench quarter rep of ltsfrenchtownfresnos land & irrigation co subdfreund sleepy hollow lake austfreyburgfreytag addfriars creek landingfriday moutain ranchfriedenfrieden subfriedrich estatesfriedrich hillfriendly hillsfriendship ln cottagesfriendship oak ph 1friendship oaksfriendship parkfriendship ranch ph iifrienship oaksfriesenhahnfrio canonfrio canyon estatesfrio canyon estates unit twofrio cielofrio cielo ranchfrio city rd. south laredo st. areafrio city rd se to ih35/90 safrio county estatesfrio estatesfrio pecan farm cabinsfrio river placefrio river place subdivisionfrio river ranchfrio valleyfrisch auf - reserve a 623frisch auf - sec 1frisch auf - sec 7frisch auf acresfritts addfritts subfritzfrmingtn cmmns condo nefronterra at westpointefronterra at westpointe - bexar countyfront gatefrontierfrontier at montana amdfrontier village sec 03fruth addfryers bendfryers creek comm subft mason crossingfulgencio bueno original grantfull gospel new light churchfullviewfulshearfultonfuqua bfuqua benjaminfurgusonfurrh #5g&b rr co abst 0225g & c hagelsteing.e. cog. farrellg. k. propertiesg.k. propertiesg0030g90pog90qn - east g-town nom-impg305m50-g305m50g305m50h - e gtown isd abstractsgabardinegabardine condogabardine condominiumsgables condogabriel farms sec 02gabriel heights subgabriels grovegabriels grove sec 01gabriels grove sec 4gabriels overlookgabriels overlook sec 01gabriels overlook sec 02gabriels overlook sec 1gabriels rdg ph 4gaddis-cole riveragage, mosesgage, william bgaines bailey surv abs #38galileo at 25 condogalindogalindo igallegos seguin isdgalvestong a mcnaughtong a mcnaughton 1st addgammagedganadogann ranch sec 01gann ranch sec 03gann ranch sec 04gann ranch sec 1ganzert park 01ganzert park 1gar-zap 407garages of texas at lakewaygarciagarcia m.j. sur.garcitas creek ranch estategarcitas creek ranch estatesgarden at willow creekgarden brook estatesgarden citygarden condo 2202garden court eastgarden ct/east/sungategarden ct east/sungategardendalegardendale areagardendale area 8 edgardendaloe area 8 edgarden estatesgarden grovegardenhillgarden hillsgarden oaksgarden oaks sec 01garden oaks sec 02garden oaks sec 05-agarden oaks sec 06garden parkgarden park sec 1garden ridgegarden ridge estatesgarden ridge estates 2garden ridge estates 3garden ridge estates 11garden ridge estates 13gardens/mayfield condosgardens/verde vistagardens/verde vista a condogardens at brookhollgardens at brook hollow negardens at covered bridge condogardens at mayfieldgardens at new braunfelsgardens at new braunfels (the)gardens at new braunfels (the),gardens at spicewood condominiumgardens at teravista condogardens at verde vistagardens at west 07 condo amegardens at woodlakegardens of balcones communitygardens of evergreengardens of hunters creekgardens of hunters creek 1gardens of hunters creek 2gardens of north ranch estatesgardens of oak hollogardens of ranch estatesgardens of sonterragardens of windcrestgardens of woodlakegardens of woodlake jdgardens western skiesgarden villagarden villa estatesgarden villas at curry loop rep lts 13-16gardosdgarfieldgarlandgarland & peavy roadgarlic creekgarlic creek west ph iii, sec 5cgarlic creek west ph iii sec 1garlic creek west ph iii sec 2garlic creek west ph iii sec 3garlic creek west ph iii sec 4agarlic creek west ph iii sec 4bgarlic creek west ph iii sec 5dgarlic creek west ph iii sec 7garlic creek west ph iii sec 8garretson, thomasgarrettgarrett, john v l evansgarretts second addgarrisongartnergary & peckgarzagarza sub no5gaston-sheldongaston-sheldon sec 01gaston-sheldon sec 02gaston-sheldon sec 02-agaston-sheldon sec 03gaston-sheldon sec 05gaston parkgaston sheldon sec 03gate hollow estates addgatehousegatehouse sub un 1gates ggatesvillegateway 26 doors condogateway condogateway condominiumsgateway parkgateway terracegatewoodgatlinburg sec 01gatlinburg sec 02gatlinburg sec 04gatlinburg subd sec 1gatlin creekgatlin creek condosgatlin crk condosgatlin crossinggatlin ranchgausegavin olguin estatesgazebo condogazebo condominiums thegazley, thomas jgazley, thomas j.gc & egc & sfrr co surv #329 abs #94g c & s f rr co surv abs 1112g dewittgdn center med. condonsg e co #50g e co #95g e co #700 multiple ltsgeneral mcmullengene rydell estategeneva estatesgeneva estates sec 01gentle grove add ph iigentle grove add repgentrygeo bachmangeo bondgeo habermilgeorgegeorge's ranchgeorge's ranch - adelinegeorge, james, tract 25george allen surveygeorge davisgeorge duty league a-41george e blackwell surveygeorge foley surv abs #17george freemangeorge james surveygeorge lucas surv #37 abs #536george s stratton surv abs #57georgetowngeorgetown 120georgetown citygeorgetown crossing ph 01georgetowne squaregeorgetown heightsgeorgetown port lavacageorgetown vilagegeorgetown villagegeorgetown village - shell ranch 3georgetown village sec 06 pudgeorgetown village sec 07georgetown village sec 07 pudgeorgetown village sec 08 pudgeorgetown village sec 09 ph 01georgetown village sec 09 ph 01 pudgeorgetown xing ph 02george w davisgeorge welshgeorge westgeorge w jones abs 475george w lindsay survgeorge w spear leaguegeorgian acresgeorgian condogeorgian condominiums thegeorgian condos negeorgian oaksgeorgian placegeorgian place ph 01georgian place ph 03georgian place ph 1georgian villagegeorg ranchgeorg ranch 7geosource subgeronimogeronimo estates unrec sgeronimo forestgeronimos havengeronimos haven #4geronimo villagegerstle pocgevers to clarkgholsongiboney trailsgibsongiddingsgideon pacegideon pace league a-230gilbert court condo amdgilbert estatesgilbert lane ph 3gilbert lane ph 4gilbert lane phs 4gilchristgilesgiles place sec 02gillelandgilleland jgillettgillis heightsgillis simongilmoregilmore wmgirving k properties unit 1glasgow mlwilliamsglasscock, george jglasscock addglen-ledge parkglen addglen allen condosglen at stone oak tglen at thomas spgsglen brookglen brook 2glenbrook add resub pt sec 1glen brook new areaglencoe at harris branchglen coveglen cove parkglendale add amdglendale gardensglendalough/toftrees/sunsetctahglendalough courtglen ellynglen ellyn sec 1glenlakeglenloch farmsglenloch farms ut-2glenmarglenn h kothmann propglennmareglennmare 1glenn priceglenn valley subdivisionglennwoodglen oaksglenoaksglen oaks parkglen ora condo amdglen royglen terraceglenview estates iglenway terraceglenwiood ph 5glenwoodglenwood addglenwood addnglenwood add resub lt 1 & ptglenwood ph 01glenwood ph 04bglenwood ph 3aglenwood ph 3bglenwood ph 4bglenwood ph 5glenwood ph 6bglenwood squareg m brass amdgoates estatesgoat hill estategoat hill estatesgoathill estatesgodfrey 01goforth hills subgoforth village sec 2gold canyongold creek condosgolden acresgolden beachgolden oakesgoldenwood sec 1goldenwood sec iigoldenwood west sec 1goldenwood west sec 2goldenwood west sec ivgoldthwaitegolf cottages of academy placegolf villa condosgolf villasgoliadgonzalesgonzales placegonzales tier add 2gonzalezpt sh 6-egonz tier 1goodgood luck acresgoodman acresgoodman surveygoodnightgoodnight & pearsongoodnight austingoodnight ranchgoodnight ranch addgoodnight ranch add phgoodnight ranch condominiumsgoodnight ranch ph 1 sec 2goodnight ranch ph 1 sec 3goodnight ranch ph 1-a sec 7goodnight ranch ph 1a sec 7goodnight ranch ph 2 east secgoodnight ranch ph 2 e sec 1goodnight ranch townhome condominiumsgoodnight ranch townhomesgoodnight townhome condominiumsgoodrumgoodwingoodwin, williamgordon c jennings abs 438gordon c jennings leaguegordon c jennings surv #35 absgordon c jennings surv abs #43gordons grovegorham 01gormangorostietadgortarigosmark subgovallegovernment hillgovernment hill and historicgovernors 02 condogovernors hill condo amdgpgrace gardensgrace valleygrace valley ranchgracy meadow condogracy meadow condo amdgracy meadow condominiumsgracywoodsgracywoods pud sec 02gracywoods pud sec 2gracywoods sec 02gracywoods sec 03gracywoods sec 04gracywoods sec 06-bgracywoods sec 08gracywoods sec 09 & 10gracywoods sec 8graef road estatesgrahamgraham, andrewgraham place condo amdgraham subdgramercy villagegranada estates sec 1granada hillsgranada hills amdgranberg subdivisiongranberrygranburygrand cypress at onion creekgrande estatesgrande prairiegrand harborgrand lakes sub sec 2grand mesagrand mesa/crystal fallsgrand mesa/crystal falls 2 secgrand mesa 02 at crystal fallsgrand mesa 04 at crystal fallsgrand mesa at crystal fallsgrand mesa at crystal falls iigrand mesa at crystal falls sec 7grand oaksgrand oaks amdgrand oaks amended subdgrand prairiegrand viewgrandviewgrandview addgrandview additiongrandview beachgrandview hillsgrandview hills sec 08grandview placegrand view ranchgrandview terrace, unit 2 & south jonestown hills,grandview terrace unit 01grange commonsgrange condominiumsgrangergranger citygranger ruralgranitegranite castlegranite covegranite hills ph igranite pointegranite pointe subgranite ridgegranite ridge at packsaddlegranite ridge at packsaddle iigranite ridge packsaddlegranite shls lake shoresgranite shoalsgranite shoals - tanglewoodgranite shoals cabingranite shoals cabin sitesgranite shoals lake estatgranite shoals lake estatesgranite shoals lake shoregranite shoals lake shoresgran sabanagrant parkgrape creek ranchgrass valleygravesgraveyard pointgravisgravity atxgravity atx condominiumsgravity atx condosgravity atx condos bldg 1gravity atx condos bldg 2gravity condosgraygray, danielgray parkgraysongrayson housegrayson parkgray tgraytowngreater gardendalegreat hillsgreat hills 01great hills 02great hills 7-agreat hills 8-agreat hills 20great hills 22great hills 23great hills ph 02 sec 01great hills ph 02 sec 02 amdgreat hills sec 3-bgreat hills sec 4great hills sec 5great hills sec 6great hills sec 7great hills sec 10great hills sec 23 ph 02great hills sec 23 ph 02-agreat hills sec 25great hills sec 28great hills sec 29great hills sec 33great hills xxgreat hills xxiiigreat northwestgreat oaksgreatoaksgreat oaks repgreat oaks subgreat sky ranchgreatwoodgreatwood ph 1 sec 1greco bendgreengreen & houston subgreen, mgreen acresgreen acres allandalegreen acres sec 1greenberry gatesgreen briargreenbriargreenbriar (sherwood shores)greenbriar ranch estates replagreenbriar sec 01greenbriar sec 02greenbriar sec 04greenbriergreenburygreenbury gates surv #63 abs #greenbury ph 01-agreenbury ph 01-bgreenbury ph 02-agreenbury ph 02-bgreencastlegreencastle (sherwood shores)greencastle/sherwood shores s4970green corner ranchgreen corners comm sec 2greendalegreendale add unit 1greenfieldgreenfield by the baygreenfield plazagreenfield subgreenfield villagegreen gate sec 01green glen acresgreen havengreen haven sub-ph 1green haven sub ph 1greenhillgreenhill 3greenhill ranchgreen hillsgreenhill sec 01greenhill sec 02-agreenhill sec 02agreenhill sec 03greenhill sec 2agreenhill villagegreen j ogreen lakegreen lake estatesgreen lake meadowgreenland hillsgreen lawn centergreenlawn estatesgreenlawn placegreenlawn place sec 02greenlawn place subgreenlawn sec 01greenlawn terracegreenlawn villagegreenlawn village condominiumsgreenleaf estates sec 02green meadowgreen meadowsgreen meadows-comalgreen meadows 6green meadows devinegreen meadows sec 3agreen meadows sec 3bgreen meadows sec onegreen meadows subdivisiongreen oaksgreen oaks estatesgreen park sec 03green pasturesgreen pastures sec 2green pastures sec 3green pastures sec 4green rd/abbott rd westgreen ridgegreenridgegreenridge ph 04greenridge ph 05greenridge ph 06greenridge phs 3green ridge sec igreensgreenshiregreenshire #3greenshire oaksgreenshores on lake austingreenshores on lake austin phs 3greenslopes/lake crk sec 7greenslopes at lakecreekgreenslopes at lakecreek sec 01greenslopes at lakecreek sec 02greenslopes at lakecreek sec 04agreenslopes at lakecreek sec 05agreenslopes at lakecreek sec 06greenslopes at lakecreek sec 07greenslopes at lakecreek sec 08greenslopes at lakecreek sec 09greenslopes at lakecreek sec 10agreenslopes at lakecreek sec 10bgreenslopes lake crk sec 04-agreenslopes ph 01greens of river oakgreens onion creek condo ph 02greenspoint heightsgreenspoint heights un #1greenspoint heights un 1greenspoint hts un 1green sprg valley gdn hmgreen spring valleygreens sec 02green valleygreen valley 01green valley 02green valley 1 amdgreen valley estgreen valley est - comalgreen valley mhpgreen valley park 1greenview on barton creek condogreenview placegreenview row condo amd 4608green vly 1greenwaygreenway lofts condogreenway lofts condo amdgreenway parkgreenway terracegreenwillow 1st extgreenwillow 2nd extgreenwoodgreenwood acresgreenwood forestgreenwood forest sec 01greenwood forest sec 02greenwood heightsgreenwood hillsgreenwood hills sec 01greenwood hills sec 02greenwood hills sec 05greenwood hills sec 06greenwood towers amdgreenwood towers amendedgreergreg, scott, hayford surveysgregg bluffgregg manor road business pagregg pointgregg ranchgregg ranch/marble falls ph 1gregg ranch/marble falls ph 2greggs j w resub of a pt of crgresham subgrey forestgrey forest canyongreyrock rdggreyrock ridgegreyrock ridge ph 1greyrock ridge ph 2grey rock village at anderson millgreystonegreystone country esgreystone ranchgreystone twnhsg r fudge 1291griffin williamgriffis acresgrimes, robt hgrissom trailsgrist mill estatesgrist mill highlands sec 1grittengritten, edwardgritten egritzka subdgroesbeckgrooms addgrosenbacher ranchgrotto springsgrovegrove/bull crk ph 1grove/bull crk ph igrove/bull crk ph iigrove at blackhawkgrove at bull creekgrove at georgetowngrove condo amdgrove condos bldg 1grove master condogrove master condosgrover parkgrover park addition phase fourgroves/lakewood ranch ph viiigroves los indios condos ph 02grubbgruenegruene arborgruene arborsgruene courtyardgruene courtyard 1gruene crossinggruene crossing 2gruenefieldgruenefield un 3gruene gardengruene leafgruene rivergruene river placegruene roadgruene road 1gruene road 3gruene road 4gruene villagesgscbc addg schumann #804g s mgtegtwguguada coma estatesguada coma estates #4guadalupeguadalupe 05 condoguadalupe 31 condoguadalupe collegeguadalupe eastguadalupe heighsguadalupe heightsguadalupe hills ranchguadalupe hills ranch #2guadalupe htsguadalupe new braunfels southguadalupe ranchguadalupe rdg-voges un 1guadalupe ridgeguadalupe ridge-eventideguadalupe river acresguadalupe river condosguadalupe river estatesguadalupe river oaksguadalupe river oaks, sec. 1guadalupe s. to laredo st(sa)guadalupe ski-plexguadalupe ski plexguadalupe square condoguadalupe square condominiumsguadalupe s to laredo st saguadalupe terrace estatesguadalupe terrace estates 1guastafierro subguenther addguenther add ncb 4022guerrero subdivisionguess dulany subguggolzguggolz addn part 2guilbeau gardensguilbeau gardens nsguilbeau oaksguilbeau parkguilbeau park un 3 ncb 18883gulf breeze place sec 2gulf states multi familygulf village 2gullett gardensgun & rod westgunderland park ran refgus becker campgustineguth parksideguth parkside annexguymontg w farmergwlg w robinsongw scott suirvey #50gyllenband #2gypsy grovegypsy grove sec bgzg_0130g_3500_1g_a0006g_a0020g_a0157g_a0191g_a0274 - robia chh & bh & t b r rh& tc railroad co 1/2 sech.c. drennerh.t. & b.r.r.h005d86h - hutto abstractshabichtshabidad condo amdhabidad condominiums amendedh a brocker subhaby hillhaby hill 50'/60'haby hill 50shaby hill 60shaciendahacienda atenashacienda condominiumshacienda easthacienda sonomahackberry acreshairstonhairy manhairy man subhajovsky 433hakes brothers at hunters placehaldeman subhale joehall addhallettsvillehallettsville townsitehallfordhalliburton add ph twohallie's covehallie heightshallie heights gardenhallies covehallies cove subhallies ranchhallmarkhalpennyhalsteadhalstead addnhalstead addn #2hamblin c ahamiltonhamilton-rasberryhamilton creek adhamilton estates phs iiihamilton pointhamilton point ph ahamilton point ph bhamilton poolhamilton surveyhamilton whammetts crossinghampton hillhampton woodshancockhancock canyonhancock estateshancock oak hillshancock parkhancock park/koreatownhank ave condo 4418hannah heightshannah heights un 4hanna valleyhanoverhanover covehansen subhansfordhansford subhansford subdhansford subdivisionhanson heightshappy acres subhappy chick meadowshappy havenhappy hollowharbor cove @ ridge harborharbor pointharbortown twnhmsharborwalk sec 2 2005harbourharbour drhardinhardyhardy addharitage farmharker heightsharkins c eharlach farmsharlandaleharlandale gardens sub ncb 7705harlandale neharlandale ne iiharlandale nwharlandale swharlandale sw iiharlemharlingenharmon, edharmon hills sec oneharmon reedharmon terrace sec 02harmony acresharmony heights add amdharmony hillsharmony hills add un 1harmony hills condos bldg gharmony hills rm'sharperharper heightsharper properharper proper nbhdharpersharrell j m surharrell john mharringtonharrisharris & wilsonharris, enochharris branchharris branch ph 01-a sec 02harris branch ph 01-a sec 03harris branch ph 01-b sec 02harris branch ph 01-dharris branch phs 1 a sec iiharris branch tr e-68 sec 1harris extharris glenharrisonharrison heirsharrison p charris park addharris park addnharris ridgeharris ridge ph 01 sec 02harris ridge ph 02 sec 01 repharris ridge ph 03 sec 01harris ridge ph 03 sec 01-aharris ridge ph 03 sec 02harris ridge ph 03 sec 03harris ridge ph 04 sec a-1harris village addharris w surhartburghartford place condohartford roadhartkopfhartkopf annexhartland ranchhartland ranch subhart ranchhartrick crossinghartrick ranchhartrick ranch ph ihartrick valleyhartrick valley estateshartwell addharvest creekharvest creek ph 1harvest creek ph2harvest hillharvest hill ph iharvest hillsharvest hills ph iiharvest meadows condoharvest ridgeharvest riidge subharvey street twnhms sssssharwoodhastings ridge at kinder ranchhatfield, b.m. surhatley park estateshaun hollow addhavana condominiumshavenhaven/teravista condoshaven estateshaven oakshaven residential condohavenwoodhavenwood at hunters crossinghavenwood hunters crossing 1havenwood hunters crossing 2havenwood hunters crossing 3havenwood hunters crossing 4hawk's landinghawkes addhawkes landinghawk ridgehawkridgehawk ridge ph 1hawkridge ph 1hayeshayes & anglehayes rch-gale sdhayneshaynes 1st ext griffin rephaynes addhayshays commerce ph 1hays commerce ph 2ahays country acreshays country oaks iihays country oaks sec 1hayslett, samuelhays wm c surhazelwood villagehazlewoodhazlewood sub ph 4ahazlewood sub ph 4bhazy hills ranchettesh bentick sv-370h b gillyh branchh burleson a-6 tract 1hdheadwatersheadwaters at barton creekheadwaters at barton creek ph 1headwaters at barton creek ph 2headwaters at barton creek ph 3headwaters at barton creek ph 4 sec 4headwaters at barton creek ph 5 sec 1headwaters barton creek ph 4 sec 1headwaters of the san gabrielheadwaters ranchheadway 08hearneheart of boerneheartstoneheartt chassheartwood park phase 1heartwood park phs 2heartwood park phs 4heatherheather condoheather condo neheatherfieldheatherfield #4heatherfield un #1heatherfield un 1heatherfield un 2heatherfield un 3heatherfield un 6heather glenheather glen 1heather glen ph 2heather glen ph2heather glen ph 4heather glen ph 5heather glen phase 1heather glen phase 2heather glen phase 3heather glen sec iheather glen sec iii phheather placeheathers / asher placeheathers coveheathers placeheatherwildeheatherwilde sec 01heatherwilde sec 02 ph 01heatherwilde sec 02 ph 02heatherwilde sec 03heatherwilde sec 04 ph 02heatherwilde sec 04 ph 03heatherwoodheatherwood condo ph 02heaven woodsh e barber addhebbronvillehecker subdivisionheflin lane condominiumshegmanheidenheimerheidenheimer originalheightsheights/stone oak 2 sub un 14heights at deerfieldheights at san gabrielheights at stone oakheights at two creeksheights at vista parkeheights at vista parke condominiumsheights comm ph twoheights comm subheights country estates phheights evergreen phase viheights hills 2nd extheights of ciboloheights of lost creekheights of westcreekheimann heights #2heimer estatesheimer gardensheissnerheloteshelotes canyonhelotes ck ranch nshelotes creek ranchhelotes crossinghelotes hillshelotes parkhelotes park estateshelotes ranch acreshelotes scenic loophelotes springs ranchelotes springs ranchhemlock hillhempsteadhendersonhenderson charleshenderson seadrifthennersby hollowhennig heights 01henrietta hgtshenry clark league abs #112henry cooke surveyhenry f hein subdivihenry fieldshenry pearlhenry rhodes abs 522henry smith leaguehenry smith surv abs #72hensley ranchherber estatesherff villageherff village phase 1herff village townhomeshe ridge at scenic hillsheritageheritage acresheritage addheritage at vizcayaheritage condo amdheritage condo amendheritage countryheritage dripping spgs ph1heritage dripping springs phase 2heritage estatesheritage farmheritage farms iiheritage farms iiiheritage groveheritage hillheritage hillsheritage hills sec 01heritage hills sec 03heritage home addheritage home add repheritage manor subheritage meadowheritage millheritage northwestheritage oaksheritage oaks, phase 7heritage oaks at pearsonheritage oaks at pearson ranchheritage oaks ph 5 & 6heritage oaks ph 5 6heritage oaks ph 5&6heritage oaks ph 7heritage oaks phase 7heritage oaks ph five & sixheritage oaks ph oneheritage oaks ph one repheritage oaks ph threeheritage oaks ph twoheritage oaks sec 1heritage oaks sec 2heritage oaks sec 3heritage on san gabriel amdheritage parkheritage park estateheritage park ns/swheritage park sec 04heritage park sec 1heritage park sec 3heritage park sec 4heritage pk sec 02heritage placeheritage place addition phaseheritage place ph iiheritage place ph ivheritage place ph vheritage place ph viheritage place village ph iheritage point/wildhorse ranchheritage point atwildhorse ranheritage point at wildhorse ranchheritage ridge clear creek comheritage square condoheritage valleyheritage walkheritage woodshermar ihermeshermitagehermitage sec 02 amdhernandos hideawayherring, johnherring legacy estatesherring legacy estates, phase 2hewitth farleyh g stokeshhh heatley; acres: 10.01h h h r resubhi-ridge trailshi circle westhickman oakshickman terracehickory creekhickory forresthickory hallowhickory haven estateshickory heightshickory hillhickory hillshickory hills subhickory hollowhickory hollow sub ut-5hickory ridgehickory ridge estateshickory springshicks valley ranchhicohidalgohidalgo ranchhidden bluffshiddenbrookehiddenbrooke subhiddenbrooke sub un 1hiddenbrooke sub un 2hidden canyon - bexar countyhidden cove and indian creekhidden coveshidden creekhidden creek estateshidden creek ph 1hidden creek ranch phs 1hidden creeks at lakewood parkhidden creek unrec subdihidden foresthidden forest estatehidden forest estateshidden glenhidden glen ph 01hidden glen ph 02-bhidden glen ph 03-ahidden glen ph 04ahidden glen ph 04bhidden glen ph 5bhidden glen ph 6-bhidden glen ph 6ahidden hillshidden hills 01hidden meadowhidden meadowshidden meadows florence ph 01hidden meadows s/dhidden mesahidden oakhidden oak 2hidden oakshidden oaks at berryhidden oaks at berry creekhidden oaks estatehidden oaks estateshidden oaks northhidden oaks north nehidden oasishidden oasis/silver leaf/elm valleyhidden oasis 2 homeowners association inchidden ranchhidden shorehidden shoreshidden spgs ranchhidden spgs ranch sec iihidden spgs sec onehidden spgs sec twohidden spgs un 1hidden springshidden springs estathidden springs estateshidden springs ranchhidden spring subhidden spring subdivisionhidden trailshidden valley estateshidden valley ph bhidden valley ranchhidden valley sec 01hidden valley sec 01 mh commhidden valley subhideawayhideout ranchhide parkhielscher sec 09hielscher sec 14higdon crossinghiggins addhigh chaparralhigh chaparral 01high chaparral 1high chaparral part 1high countryhigh country estateshigh country gdn homeshigh country rancheshigh country sec 03high country un 4high creek ranchhigh creek ranch phs 2high cresthighcrest mdw sec 2high crest ph ihigh crest ph iiihigh crk ranch ph 2high crk ranch ph twohigh crossing ranchhigh gabrielhigh gabriel easthigh gabriel west sec 01high gabriel west sec 02high gardenhigh hat mountainhigh hill ranchhighlandhighland acreshighland acres easthighland additionhighland branchhighland club village sec 01highland club village sec 02highland condoshighland creek lakes sec 01highland creek lakes sec 1highland dev corporatihighland estatehighland estate of beltonhighland estateshighland estates #2highland estates of beltonhighland estates ph iihighland estates ph iiihighland farmshighland farms subhighland farms two(jd)highland foresthighland grovehighland grove 1highland grove 3highland grove 6highland grove un 9highland grvs unit-10highland havenhighland heightshighland heights addn 1st exthighland hillshighland hills northwest sec 1highland hills northwest sec 2highland hills northwest sec 6highland hills ranchhighland hills sec 05 ph 01highland hills sec 05 ph 02highland hills sec 06 ph 02ahighland hills sec 08highland hills sec 09 ph 02highland hills sec ivhighland hills un 15 ncb 10854highland horizonhighland horizon ph 01highland horizon ph 02highland horizon ph ivhighland illshighland lake estatehighland lake estateshighland lake estate sec 21highland lake estates sec 02highland lake estates sec 03highland lake estates sec 04highland lake estates sec 05highland lake estates sec 06highland lake estates sec 07highland lake estates sec 08highland lake estates sec 09highland lake estates sec 5highland lake estates sec 6highland lake estates sec 8highland lake estates sec 10highland lake estates sec 11highland lake estates sec 12 ahighland lake estates sec 13 ahighland lake estates sec 14highland lake estates sec 15highland lake estates sec 18highland lake estates sec 20highland lake estates sec 21highland lake estates sec 22highland lake estates sec 23highland lake estates sec 24highland lake estates sec 25highland lake estates sec 26 ahighland lake estates sec 26 amdhighland lake estates sec 28highland lake estates sec 29highland lake estates sec 30highland lake estates sec 31highland lake estates sec 32highland lake estates sec 33highland lake estates sec 34highland lakes acreshighland lakes estateshighland lake villashighland lake villas resubhighland lake villas resub ofhighland lk ests sec 25highland mdwshighland mdws ph 2ahighland mdws ph 2dhighland mdws ph 2ehighland meadows - wilson counhighland meadows - wilson countyhighland meadows sec iihighland meadows subdivisionhighland oakshighland oaks 1st add rephighland oaks estates sechighland oaks hoahighland oaks ph 1highland parkhighland park addhighland park additionhighland park condo amdhighland park courthighland park est.highland park estates amdhighland park ncb 3315highland park north ph a sechighland park north ph a sec 01highland park north ph b sechighland park north ph b sec 02highland park north ph c sechighland park north ph c sec 01highland park ph a sec 01highland park ph a sec 2ahighland park ph a sec 2chighland park ph b sec 03highland park ph b sec 1 amdhighland park ph b sec 4highland park ph b sec 7highland park ph b sec 8highland park ph b sec 10 & 1highland park ph c sec 1highland park ph c sec 2highland park ph d sec 01highland park ph d sec 02highland park ph d sec 3highland park ph d sec 4highland park ph d sec 6highland park phs d sec 4highland park townhomeshighland park westhighland park west condo amdhighland park west condominiums amehighland park west sec 02highland park west sec 04highland pk north ph b sec 1highland ranchhighland ridgehighlandshighlands/crystal falls sec 1highlands/crystal falls sec ihighlands/mayfield ranch sec 1highlands/mayfield ranch sec 3highlands/mayfield ranch sec 4highlands/mayfield ranch sec 7highlands/mayfield ranch sec 8highlands/mayfield ranch sec 9highlands/university hillshighlands/university hills sechighlands at crystal fallshighlands at crystal falls sec 02 ph 01highlands at crystal falls sec 02 ph 02highlands at mayfield ranchhighlands at mayfields ranchhighlands at oak foresthighlands at woodlakhighlands condoshighlands condos nehighlands easthighlands lake estateshighlands northhighlands north sec 2highlands north sec 3highland southhighlands ranchhighlands thehighlands university hillshighland terracehighland terrace annex ph ihighland terrace ihighland terrace kenhighland terrace ph 1highland villagehighland village ph 1highland village ph iihighland village sec 01highland village sec 02 pt 01highland village sec 02 pt 02highland village sec 02 pt 03highland vista office condominumshighland vista office condos bhigh lonesome ranch east sub thighmarkhighmark condohigh meadows ph 01 sec 01high meadows sec 05high meadows sec 07high meadows sec 2high meadows sec 3highpointhighpoint at westcreekhighpointehighpointe condohigh pointe estateshighpointe ph 2 sec 2ahighpointe ph ii sec two-bhigh pointe ph i sec onehighpointe ph i sec three ahigh pointe ph iv sec one-bhigh pointe ph iv sec twohigh pointe ph v sec onehighpointe ph v sec threehighpointe ph v sec twohigh point ranch subdivisionhighridgehighridge farmshigh ridge meadowshigh ridge meadows subhigh ridge ranchhigh river ranchhigh school addhigh school terracehighsmithhighsmith, a mhightop ridgehighviewhighview 2ndhighview 3rdhigh view meadowhigh view ranchhigh view ranch, ph 3ahigh view ranch ph 3ahigh view ranch subdivision, phigh vista condoshighway 90 ranchhighway addhighway commercial addn.highway frontage w hwy 158 and paint creek loophilcresthillhill & dale addhill,william w.hill acreshillandale 2nd sechill country covehill country estateshill country gardenshill country glen allen condohill country ph 02-ahill country rancheshill country ranches unit twohill country retreathill country retreat del webbhill country villagehill country villashill creekhill creek westhill cresthillcresthillcrest 1hillcrest 2hillcrest acreshillcrest addhillcrest estateshillcrest park subhillcrest ph 02hillcrest phs 2hillcrest sec 02hillcrest sec 03hillcrest sec 04hillcrest sec 1hillcrest sec 3hillcrest subdhillcrofthilldale ranchetteshilldell estateshill h phillridge addhills/westwood ph ivhills/westwood ph xihills/westwood ph xiiihills/westwood ph xivhills @ boerne stagehills and daleshills at estanciahills at iron horse canyonhills at river misthillsborohillsidehillside/landa un 2hillside/spanish oakshillside acreshillside amd thehillside at spanish oakshillside condominiumshillside estateshillside estates ph onehillside j h moore 1/2 lg a071hillside oakshillside on landahillside subhillside terracehillside village tr a bhills lakeway ph 01hills lakeway ph 02hills lakeway ph 03hills lakeway ph 04hills lakeway ph 05 amdhills lakeway ph 06hills lakeway ph 08hills lakeway ph 08-ahills lakeway ph 09hills lost creek sec 04 ph ahills of banderahills of bandera ranchhills of bear creekhills of bear creek, ring tract phs 2hills of bear creek sec 1hills of bear creek sec 2 thehills of bear creek sec 3hills of cielo-ranchhills of cross canyon ranchhills of estanciahills of hays ph 1hills of hays ph 2hills of lakewayhills of lakeway ph 02 rephills of lakeway ph 02 the amd, hills lakewayhills of lakeway phs 9hills of madrone ranchhills of mustang creek amdhills of rivermisthills of shady grovehills of shaenfieldhills of stone oakhills of texas estateshills of westwoodhills of westwood phhills of westwood ph ihills of westwood ph iihills of westwood ph iiihills of westwood ph ixhills_and_daleshilltophilltop acreshilltop acres achilltop acres ph 4hilltop addhilltop additionhilltop lakeshilltop lakes sec 118hilltop mdws un 1hill top oakshilltop placehilltop place sec 1hilltop place sec 2hill top ranchhilltop ranchhill top rancheshilltop rancheshill top ranch subhilltop ranch sub, lot 14 (u-1), acres 5.107hilltop springs ranchhilltop viewshilltopvillagehill view addhillview add sec 1hillview greenhimmelblau unrec subhineshines, elberthines rancheshines w acr sur 53 abs 345hinton addhistoric gardenshistoric palestinehitchcockhivue additionh j carterh mc croryhmd106h m lehahoagland addhobbs addhobsonhobson johnhockleyhocks addhodginshoffmanhoffman charleshofheinz resubhogg creek bus parkholan hill subholcomb additionholderholdermanholderman, davidholderman, jessehole in add 01holiday beachholiday beach hillcrestholiday beach westholiday heights sec 01holiday hillsholiday hills sec 01holiday hills sec 02holiday lakesholiday square condo amdholiday villages of medinaholiday villages of medina meholiday villages of medina medina lake estatesholiday villages of medina rio medina ii sectionhollandholland estatesholland hillsholland originalholland parkholland park subholland ranch estates subhollow/slaughter crk sec 01hollow/slaughter crk sec 1hollow at inwoodhollow at slaughter creekhollow at slaughter creek sechollow at slaughter creek sec 1hollow condoshollow estates unit 2hollow oakshollow ranchhollowshollows canyons sec 1hollows canyons sec 2hollows condo amd thehollows condo hilltop vihollows of northshore amdhollows ph 2c thehollows ph 3ahollows ph 3a thehollows phs ii-c thehollows sanctuary south ph 1hollubholly & naumannholly-naumannholly bellholly brook estateholly condosholly house condominiumsholly naummannholly parkholly street condoshollywood 1st exthollywood addhollywood parkholt carsonholtonholton tillery acres subholtzclaw, b.w.holy cross heights resubholy trinity subhom condoshome placehome place/jarrellhome place/jarrell 2 minorhome place/jarrell 2 minor amdhome place/jarrell 2nd minorhome place/jarrell 2nd minor ahome place/jarrell ph 1home place/jarrell second minohome place at jarrellhomesteadhomestead 2homestead 3-ahomestead 24homestead at old settlers parkhomestead estateshomestead hillshomestead oakshomestead ph 1 finalhomesteads/deer crk ph ihomesteads at deer creekhomestead sec 03homestead townhomes condohomestead twnhm condoshomestead village townhomeshometown kylehometown kyle ph 01hometown kyle ph 1hometown kyle ph 3 sec 1hometown kyle ph 3 sec 2hometown kyle ph 3 sec 3hometown kyle ph 3 sec 4hometown kyle ph 3 sec 6hometown kyle ph 4 sec 1hometown kyle phase 3 sec 4hometown kyle sub ph 2homewoodhomewood heightshomewood placehondohondo oakshondo ridgehondo ridge subhondo ridge subdivisionhondo ridge subdivsionhoneycomb hillshoneycomb hills / roundmountain oakshoneycomb hollowhoney creekhoney creek condominiumshoney glen acreshoney hillhoney ridgehoodhood-davishood addhood view addhooker 1 pochooker 2 pochooper richard 04hooten addhoover valleyhope alliance crisis center subdivisionhope community church addhopedale estateshope prosperhopkins dhopson ranch estateshorace eggleston surv #24hord limited partnership addnhorizon 01horizon lakehorizon lake ph 1 sec 1horizon lake ph 2 sec 1horizon lake ph 3 secs 1 & 2horizon lake ph 4 sec 1horizon lk ph 1 sec 1horizon parkhorizon park sec 01 pts blk abt & r amdhorizon park sec 1horizon park sec 2horizon park sec 4horizon park sec 5horizon park sec 6horizon pk sec 06horizon pointehorizon ridgehorizon subdhornsby, j. sur., acres 12.569hornsby bend sec 01hornsby glen ph 01horse creek ranchhorseshoe bayhorseshoe bay - properhorseshoe bay nhorseshoe bay northhorseshoe bay phorseshoe bay properhorseshoe bay prosperhorseshoe bay southhorseshoe bay whorseshoe bay westhorseshoe bendhorseshoe bend sec 02horseshoe bend sec 03 amdhorseshoe fallshorseshoe falls bus parkhorseshoe falls estates 1horseshoe falls estates 2horseshoe lakehorseshoe lake ranchhorseshoe oakshorseshoe southhorseshow bay properhorsts louishorton ranchhosick ranchhoskinshospital heightshot wellshotwellshouse creek north phase 1house creek north phase 2house creek north phase 3house creek phase 3house port addnhoustonhoward estateshoward lane ph ihoward ranchhoward ranch commercial condo regimehoward ranch sec 1howard ranch sec 2howard rungehoward subhoward subdivisonh p landhr 79 sub ph 1 & ph 2hshsbhsb - properhsbphsb properhsb so reshsbwhsb westh schleyht & b railroad co certificatehttps://www.thesummitspringshoa.com/huhubbardhubbard branchhubbard branch addhubbard branch add phhuber lindyhubert additionhudson at belterra condohudson bendhudson bend colony 01 resubhudson bend colony 02hudson bend colony no 2hudson bend colony sec 03hudson bend roadhudson farmshudsons addhuebner villagehueco spgs ranches 2hueco springs rancheshueco sprng rchhueco sprng rch 2huff estatehuffmanhugheshughes addhughes add 02hughes gardenshughes park lake 01hugh mccollum surv abs #488hughson heights 02hughson heights ihughson heights iihughson heights sec 03 chughson heights sec 3-bhughson heights sec 3-chughson heights sec 3chumblehummingbird estateshunthunt crossinghunter's ridgehunter hillhunter oakshunter ridge ihunters chasehunters chase 3hunters chase sec 01hunters chase sec 02hunters chase sec 03hunters chase sec 04hunters chase sec 05 amdhunters chase sec 06hunters chase sec 07 amdhunters chase sec 07 amd pt amdhunters chase sec 2hunters chase sec 4hunters chase subhunters creekhunters creek 8hunters creek 9hunters creek northhunters crossinghunters crossing sec seven bhunters crossing sec threehunters crossing sec three dhunters crossing section 3-e, block a, lot 5,hunters glenhunters glennhunters glenn sec 01hunters hillhunters hill sub sec 2hunters lakehunters millhunters placehunters pondhunters ranchhunters ranch subhunters ridgehunters wayhunter william hhuntingtonhuntington at shavano parkhuntington estateshuntington placehuntington trailshuntington trails/forest creek estateshuntland heights sec 01huntland heights sec 02huntleigh parkhuntsvillehunt villashurlbut ranch westhursthurst placehurst place ph 5hurst place ph 6hurst place ranchhurst place sub ph 3hurst place sub ph 6huston ranchhuston sam heightshutchins emmahuttohutto & metcalfe addhutto abstractshutto cityhutto crossinghutto etjhutto highlandshutto highlands sec 01 ph ahutto hlnds ph 2 sec 2hutto hlnds ph 3 sec 2hutto hlnds ph b-1 sec 1hutto industrial parkhuttoparkehuttoparke sec 01huttoparke sec 02huttoparke sec 05huttoparke sec 5huttoparke sec 7hutto square sec 01hutto square sec 02hutto square sec 03hutto square sec 4hutto square sec 5ahutto square sec 5bhutto town squarehutto town square northhutto transitionalhutto xinghutto xing ph 2hutto xing ph 3 sec 1hutto xing ph 4hutto xing ph 4 sec 5hutto xing ph 4 sec 9bhutto xing ph 4 sec 10hutto xing ph 4 sec 10, carmel creekhwhwy 7 estatehwy 79 east 210hwy 90 east annexhwy 290hyak - davig subhyde parkhyde park addhyde park add 01hyde park add 02hyde park addn no 1hyde park annexhyde park condohyde park oaks condohyde park terrace condohyehye farmshye springs ranchhymanhymeadowhymeadow estateshymeadow office park condoshymeadow ph 1 sec 2hymeadow ph 1 sec 3hymeadow ph 2 sec 3hymeadow wood office park condoshymesa estates ph fivehymesa estates ph onehymesa estates ph seven sechyridgehyridge resub lts 01-15 blk b blkhyridge resub lts 02-16 blk c blki, iii. & g.n.r.r. co. sur.i0320-i0320i035d95e - lh isd - south hwy 29 / west of ronaldi35 so. to e. houston (sa)i35 so. to e. houston sai35 so to e houston sai212317d - liberty parkei bunkeri bunker sur aw0054ida creekid coulter surv #624 abs #132ideal placeidle acresidyle hour acresig & n railroad addih-35 corridorih10 north west / northside boerneih 35 to fm 1518. left on aero ave.i jonesimagine centerimpala isleimperial condoimperial plazaimperial trace sec 01imperial valley sec 01 amdimperial valley sec 02independence heightsindependence hillsindependence park condoindependence park condo amdindependence park condominiumindependentindependent condominiumsindependent condosindian & comal hillsindian creekindian crossingindian gapindian harbor ph 18indian hillindian hillsindian hills estates 1indian hills ranchindian hills sec 03indian hills sec 04indian hills sec 05indian hills sec 5indian hills subindian lakeindian lake sec 2indian lake section 1indian lakes ph 17indian oaks subindianola club groundsindian paintbrush acres addindian paintbrush ph 04aindian paintbrush ph 2indian paintbrush ph 3indian paintbrush ph 4aindian paintbrush ph oneindian paintbrush sec 04bindian paintbrush sec 4bindian pointindian point at point ventureindian ridgeindian ridge at messer ranchindian ridge sec 01aindian spgsindian spgs estates north sindian spgs ranch #1indian springsindian springs lake estatesindian springs ranchindian trails sec 1 repindian valleyindian watersindustrial addindustrial add annexindustrial park northindustrial park subinezinfinity squareinglesideingleside-r j williamsingleside condos bldg 10ingleside condos bldg 12ingleside on the bayingramingram hillsin hoc signo vinces subdivisioninks lake villageinland estatesinnerinner town/gonzalesinside loop 410 northeastinspiration hill # 2inspiration hillsinterchange bus park sec 1invernessinverness new braunfelsinverness pointinverness sub bl 6850inwoodinwood coveinwood estatesinwood parkinwood placeinwood terraceinwood terrace iinwood terrace iiinwood terrace iiiiolai p jones subi p pullumira townhomesiredelliron horse canyoniron mountain farmsiron mountain ranchirons & grahamsirons & grahams addirons & grahams additionironwood at crestwayirvin addirvineirvingirwinirwin smithisaac-wilsonisaac campbell surv a-79isaac decker leagueisaac donagan surv abs #178isaac jacksonisaac lindsey surv abs 476isabella condominiumsisherwood heightsisland/lk travis condoisland at mount bonnell shoresisland bus centerisland lodgesisland mooringsisland on lake travisisland on lake travis condoisland on lake travis condo amdisland on lake travis condominisland on lake travis condominiumislands/rockport un 2island villageisland village condoisland village hsbisland village westislasitascai texas grand ranch ph 5ivy 78704 condo amdivy 78704 condo amd theivy on kinney condo amdj & m add iij & m add rep lt 3 blj & s subj & s subdj&s subdj-t whitesides league a-107j.a. harris additionj. bevilj.k.p mcfalls subdivisionj.t. farquharj001llli-jarrell isd vacant landj002d35h - jarrell isd rural before 1990j002d35h-jarrell isd rural before 1990j306o17e - jarrell condos (lgi)j601llli - grnger isd abstracts/vacant landj410335i - bartlett cityjajack halljack herring homes addnjacksborojacksonjackson, gabrieljackson estatesjackson park manorjackson woodsjacks pond sec 01jacks pond sec 03jacob acres unit iijacob career leaguejacob reed surv abs #48jacobs acresjacobs landingjade oaksj a estatesja gabbartj a gutierrez sv-1059jahn addjakes colony subdjakubikjakubik addjalufkajamaica beachjamaica beach 1jamar villagejames a prevvitt surv abs #288james bell survjames brooking addjames daugherty surv abs #201james e burke acresjames george abs 9james h. johnsonjames knight & walter c whitejames lansing surveyjames lewisjames m thompsonjames p wallace leaguejames p warnock surv abs #12james r cookjames robinson league a-270james r shannons resubjames sheilds surv a-323jamestownjamestown iijamestown placejamestown place condo amdjamestown sec 01jamestown sec 02jamestown sec 03jamestown sec 04james warren a-673jamesway add ph fourjamesway add ph onejamesway add ph threejamesway add ph twojanakj a navarroj andersonjanecka comm repjanischjanoe subjanstar placejaponica estatesjaramillo acresjarelljarrelljarrell addjarrell isd 1970jarrell isd ruraljarrell isd vacant landjarrell isd vacant land / am30ddxi - mh sfl/sjajarrell townjarrell town centerjarrell town center ph 1jarrell town ofjas mccormickj a smithjasperjasper gilbert survjasper heightsjasper heights 4thjasper heights 8th rep ltjasper heights 8th rep ltsja tivy addja tivy addnj a wohlers surv #407 abs/621jaxon park subdivisionjay barjaybar ranchjay bar ranch nsjaybar ranch un 1j a york abstj b berry surv abs56jb daniel surv abs 259j beardj benedictjb johnson surv abs 260j bouldin residencesj branhamj b smithj c darstjc duvaljc harrelsonj cliftjc tannehill leaguej c tannehill league sur 29j c tannehill surv 29 abs 22j curriejc waltersj de la garza surj delgado surj d smithj d smith div pcl 1aj ebberly surveyjeddo ranchesjeffersonjefferson heightsjefferson heights 3rd add ncb 6456jefferson manorjefferson manor second secjefferson manor second sectionjefferson placejefferson square condo amdjefferson terracej e lay addje maddera a0600bcjenkins, edwardjenkins ralph ljenningsjennings branch estatesjennings placejentsch acresjerry barbeejesse bartlettjesse b eavesjesse b eaves survjesse burdettjesseljessells addjesse strother 1/3 league absjesse thompson tract abs a1347jesse white surv abs #379jester estatejester estate sec 01 ph 01jester estate sec 01 ph 02jester farmsjester farms sec 02jester farms sec 03jester farms sec 04jester farms sec 05jester farms sec 07jester farms sec 08jester farms sec 09jester farms sec 10jester king ranchjester point 02 sec 04jester point 02 sec 06-bjester point 02 sec 08j e taylorjettjett jjet viewjewel and betty banks subdivisionjewettjf carlton survey #98j f schwertner sub 1stj g & henry fitzhugh subj georgej gilbert n fm 116j goslin surv abs #344j g pfeuffer abst #594j hamilton surv abs 82j h dibrellj h evittsj h hartmanj highlandj h johnson surv #16 abs #477j howard survey 15 1/4j h thomas addj hughs a0379bcjim miller rd 300fr lake june co-dallasj jettj j fischerj k campbellj kemlenj kirkj lewisjl mccrocklin surv #15 absj l rev harrisj matterj m balmaseda surjm caffeyj m capej m musquez surv #409j m stone addjm turner subj mullerj m uranga abst 68j m veramendijn & h subdivisionj n arocha 4 league grant absj n arocha surv abs #444j n koening subj n smithjoan/jean darrigand survjohn a neilljohn a neill a-20john baileyjohn bartonjohn barton surveyjohn b berry surv #56john b cowan surv a-84john berry surv abs #51john brown surv a-35john cain surv abs #154john caruthers surv abs #127john caruthers surv abs #2700john castleman league abs #31john durst grant abs #15john d wright surv a-125john frederick geisterjohn g. king surveyjohn g first townsjohn goodman surv a-241john hallett leaguejohn hamiltonjohn hamilton surv/#1 abs #405john hamilton surv abs405john henry tr 9 a012john h finch surv a-108john h moore commjohn h moore lgjohn ingram surv abs 256john knoxjohn knox acresjohn malone surv abs #594john mayjohn may leaguejohn mcclure a-392john mcdonald surv #102john mcdougaljohn newcombe estatejohnny kim add iijohn redfernjohn scottjohns c rjohns c r, eastgate condominiumsjohnsonjohnson charles addjohnson cityjohnson djohnson farms subjohnson farms subdjohnson f mjohnson helenjohnson j sjohnson ranchjohnson ranch - comaljohnson ranch -comaljohnson ranch north 1johnsons l c resubjohnsons river addjohnson travis viewjohn sowelljohn stewart survjohnstonjohnston add to blmtjohnston terrace sec 02johnston terrace sec 05johnston terrace sec 07johnston terrace sec 08john wellsjohn wessels subjohn wheatonjohn williams survjolly w tjonahjonah estatesjonas woodsjonas woods #3jonathan covejonathan nixj o neal selma addjonesjones & moores addjones - complexjones additionjonesborojones i pjones m ljonestownjonestown hiilsjonestown hillsjonestown hills unit 03 amdjonestown hills unit 3jonestown hills unit 5jonetown hillsjordanjordan's creek (common) / jacobs acres(legal)jordan's ranchjordan creekjordan motor co sub 2 resujordans creekjordans ranchjose, lealjose antonio depena surv abs #jose antonio navarro 7 leaguejose antonio navarro a-18jose antonio navarro surv absjoselealjose leal, a-290jose leal a0290jose maria hernandez surv a-59jose mario sayes surv abs #347jose miguel cortez surv abs #9joseph, b. sur.joseph berry svyjoseph b young abs #750joseph edwardjose san pierre surv abs pcl/gjoseys northjoseys southjosh ritchey subdivisionjoshuas crossingjoshuas crossing ph twojoshua williamsjourdantonjourdanton blockjoynerjoy pocj parrott abstractj p ellis sec 2j p l subj poitevent abstj q cliett iijrb williams surv #88 abs #169jrl #2j roden surj r ranchettes ph iij r smithj s irvinej s johnsonjs life commjs oconnorj s ryanj s smithjs underwood sure abs #1123j t brumfield & w f hearnej thompsonj thomsponj t ltd resub 03j t monroej t steelman surv a-746juan jose acosta surv abs 1juan m veramendijuan m veramendi surv #2juan m veramendi survey #1juan m veramendi survey #2judson candy factoryjudson crossingjudson heightsjudson valley subdjulius alexander indust sujunctionjuniper ranchjuniper springsjupe/manor terracejupe manorjupe subdivisionjusterjustinj vannoyj ware surv abs645j westj west surveyjw g pierson league surv a-84j w harrisj winnjw ranch estsk-bar-mackachina vistakai vista estate sec 1kallenbergkallison ranchkallison ranch 215 ph 1 un 12akallison ranch iikallison ranch ii - bexar countykallison windgatekamirakamp kendrickkamreijo subkaplerkarlyn ranchkarm - medina countykarneskarnes citykarnes heights 1 karnes citykasparek addkasparek addnkasperkasper sec 1kasper sec 2kasper sec 5kasper sec 10kathryn heightskathy & francis jeankatykaty addkaty condoskaty cove estateskaty crossingkaty crossing sec 01 pudkaty crossing sec 02 pudkaty crossing sec 03-a pudkaty crossing sec 03-b pudkaty crossing sec 04 pudkatymeadkatymead sec 02katy waykatzer ranchkayden springsk c estatesk c estates sec 04kee-elke kekellar farmskeller heightskellers landing subkellers lndg subkelleykellum-rotan subkellykelly nicholskellywood estateskelm estates sec 01kelm estates sec 1kelseykempkempnerkempner ranch sec ikempner village estatekenai bus park condoskendaliakendalia rancheskendall brookkendall brooks/liberte venturakendall brook unit 1bkendall creek estateskendall oakskendall pointekendall woods estatekendall woods estateskenedykennedykennerly resubkenney fort sec 2kenny hill addkenray condokensington place 1kensington place sec 01kensington place sec 03kensington ranchkensington ranch iikensington row condonskensington trails sec 01kensington trails sec 1kensington trails sec 2kensington trails sec 3akensington trails sec 3bkensington trails sec 4akensington trails sec 4bkensington trails sec 5akensington trails sec 6kenton placekenton place nskenton place twokentshire place sec 1kentwood manorkenwoodkenwood/zillakerbow subkerenskern acres 1st ext & revkern acres 2nd ext & revkernaghan additionkern terrace 2nd extkern terrace 3rd extkern valleykern valley 2nd extkerr, wm pkerr donationkerrvillekerrville coukerrville country estateskerrville southkerrville south iikesington rowkessler addkestrel air parkkey allegrakey allegrokey allegro condominiumskey allegro unit #1key halk port lavacakey largokey ranch at the polo clubkeystone addkeystone historic districtkeystone iiikielmankielman subd #3kilgorekilleenkilleen heights 4th sec 1skilleen heights north unit 1stkilleen heights south unit 2ndkilleen mall subdivision replatkilleen mall sub replakilleen originalkilleen paint & body addkilleen watercrest dtp viiikillen william hkim addkimbels acrekimble oaks ranchkimble oaks ranch property owners associationkimbrokimbro creek estates sec 02kimbro lkimbrough & lisa gray add (townhouse/common)kims autokincheonkincheon sec 01kincheon sec 02kinder northeast ut-6akinder ranchkinder ranch prospect crkkinder ranch settlers ridgekinder west un-4 cb 4854kingking's landingking's point coveking's sixth addking countrykingdom heights sec 1king oaksking o hillking park addking park additionkingsboroughkingsborough ridgekingsburykingsbury park subkings covekings cove 1kings crossingkings crownkings gate at lake medina unkingslandkingsland covekingsland cove unit 1kingsland estateskingsland hillskings landingkingsland railroad southkingsland ranchkings pointkingsridgekings row condoking st duplex subkingstons estatesking streetkings villagekings village sec 02 pt 01kingsvillekingsway add ph onekingsway add ph twokingsway add ph two sekingsway ph sevenkingswoodkingswood/sherwoodkingswood addkingswood heightskingswood sec 1king w aking williamking william - st benedicts loftskingwood estateskinney ave condo amd 2002kinney estateskinney lofts condokiolbassa estateskirbykirby manorkirby spgs ph ii resubdkirby spgs ranch ph ikirby spgs ranch ph iikirby terracekirkkirk heightskirkpatrickkirkwoodkissing treekissing tree 55+kissing tree cottageskissing tree cottages condokissing tree villas condokitty hawkklklattenhoff office condo newklepac mhpknight, jas & wcwhiteknights ridge add ph tknights ridge ph one sectioknippaknob creek blk 1knob crk ranchknollcreekknollcreek townhouseknoll ridgeknolls of woodlakeknollwood on the coloradoknollwood on the colorado riveknollwood on the colorado riverknollwood on the colorado river sec 01knox rdg ph 1 un 2knox ridgeknox ridge northwestkoala parkkoala park 1st extkoch #1kociankoeglar hillskoenig placekoenig terrace sec 01koenig townhomeskohlenberg 1 aka legacy @ lake dunlapkoiglar hillskoinonia pointkollman oakskomenskykontiki bayfront condominiumskool oasiskossekovar communitykramerkramer farmkramer heights condominiumskrausekreuslervillekriewald placekriewald rdkrizovkruegerkubitz placekuehler addkuempel estateskuempel farmskuempel tr ph 01 sec 02kuempel tr ph 02 sec 03kuempel tr ph 03 sec 05kupfernagel subkutscher ranch estatesk w bartonleague a-3kwed radio subkwed radio subdkylekyle 47 sub ph 1kyle 47 sub ph 2kyle heights sec 2kyndwoodkyndwood un 1kyntol & p propl & r bus parkl50 - leander/cedar park vacantl50ef - fast food restaurant-leander/cedar parklaan condosla bahiala cancionla canterra sec 02la carretala cascadalacey parklachapelle idz-2 ncb 2582la chenay condominiumsla cierra at sonterrala cimala cima (san marcos)la cima: 70ft. lotsla cima ph 2 sec ala cima ph 2 sec bla cima ph 3 sec ala cima ph 3 sec bla cima ph 4la cima ph 5ala cima ph i sec 1la cima ph i sec 2lackey estatelackland citylackland city sub un 210lackland heightslackland heights subslackland terracela conterala conterrala conterra north ph 1la conterra north ph 2la conterra sec 01la conterra sec 6la conterra sub sec 2la conterra sub sec 5ala conterra sub sec 7la costalacostelacoste acresla coste heightslacrosse sec 01lacrosse sec 02lacrosse sec 03lacy lansladdsladeraladera - 50sladera - 60sladera at lulingladera enclaveladera highpointladera in lulingladera laurel hollowladera north ridgeladera ph 1ladera ph 4aladera ph 4bladera un-1clafayettelafayette placelafayette place condo amdla fontana villasla gloria land adjlago de leonlago escondidolago marlago ranchos sec 01lagoslagos communitylagos ph 1lagos ph 2lagos reservelago terra ph iilago villalago vistalago vista civic center addlago vista country club estalago vista country club estatelago vista country club estateslago vista country club estates sec 01lago vista country club estates sec 02lago vista country club estates sec 11lago vista estateslago vista estates sec 04lago vista estates sec 05lago vista estates sec 06lago vista estates sec 07lago vista estates sec 6lago vista sec 01lago vista sec 02lago vista sec 03 ph 01lago vista sec 03 ph 02lago vista sec 03 ph 03lago vista sec 03 ph 04lago vista sec 1lago vista sec 3lago vista travis plazalago vista villas condolago vista villas condominiumsla grangelagrangelaguna loma sec 2laguna san luis 88laguna vistalaguna vista subdivisionla hacienda estatesla hacienda estates sec 02lairsen addla isla at angel bay sec 02lajitasla jollala joyalake addlake add 3rd seclake add 4th seclakeaire sec ilakeaire sec iilake austin villagelake bastrop acreslake bastrop club and lake bastrop acreslake bastrop estateslake bastrop estates un 1lake bastrop estates un 2lake bastrop estates un 3lake bastrop pineslake bastrop ranchetteslake breezelake chandonlake citylakecliff a lake travislakecliff on lake travislakecliff on lake travis sec 07lakecliff on lake travis sec 1lakecliff on lake travis sec 3lakecliff on lake travis sec 6lakecliff on lake travis sec 8lakecliff on lake travis sec 9lake conroe hills 02lake countrylake country estateslake country village 01lake creeklake creek at anderson milllake creek estatelakecrest add ph fourlakecrest add revlakecrest on the hill amdlake crk villas condolake forestlake forest 02 village 01lake forest 02 village 03 ph 02lake forest 03 village 02 revlake forest 03 village 03 revlake forest addition ph3lake forest ranchlake forest sec 01lake forest sublake forest sub secii ph i relake front courtlake front hideawaylakefront hideawaylake front hideaway 1lakefront homes condominiumslake georgetown estateslake highlands blk 1-alakehillslakehurstlakehurst resublake jacksonlakeland hills sec 02lakeland parklake lbg villagelake limestone coveslakeline centerlakeline center condolakeline center condo bldg 32lakeline center condos bldg 2lakeline center condos bldg 12lakeline center condos bldg 25lakeline center condos bldg 27lakeline commons 02lakeline oaks sec 2lakeline oaks sec 3lakeline oaks sec 5lakeline office park condolakeline ranchlakeline ranch ph 01lakeline ranch ph 02lakeline ranch ph 04 amdlakeline ranch ph 05lakeline ranch ph 06lakeline ranch ph 07 amdlakeline ranch sublakeline square condolake marble fallslake mcqueeney estateslake mc queeney estates #4lake medina highlandlake medina highlandslake medina highlands blake medina shoreslake medina shores elake oak estateslake oak estates sec 01lake oakslake oaks landinglake oaks ranchlake of the hillslake of the hills estlake of the hills estateslake of the hills westlake placidlake placid estateslake pointelake pointe crossinglake pointe ph 01blake pointe ph 02lake pointe ph 04-alake pointe ph ilake pointe ph ii-a1lake pointe ph iiilake pointe sec 03 ph 01lake pointe sec 06lake pointe sec 07lake pointe sec 09lake pointe terracelake pointe terrace ph 1lake pointe terrace ph 3lake pointe terrace ph ilake pointe terrace ph ii a-ilake pointe terrace ph iiilake point rnch bandlake point terracelake ridgelake ridge at canyon lakelake ridge at canyon lake 1lake ridge at canyon lake 3lake ridge estateslake ridge estates sec 01lake ridge estates sec 02lake ridge estates sec 03lake ridge estates sec 3lakeridge heightslake ridge on rough hollowlakeridge townhomeslake ridge village #2lake sandylakes at northtown sec 02lakes at northtown sec 03lakes at northtown sec 04lakes edgelake shore addlakeshore beachlake shore estateslakeshore estateslakeshore ranch 01 resublakesidelakeside & greens condolakeside - stdlakeside/blackhawklakeside 01-blakeside acreslakeside at blackhawklakeside at blackhawk 02 ph 1alakeside at blackhawk iii phlakeside at blackhawk sec 01lakeside at blackhawk sec 02lakeside at blackhawk sec 04lakeside at canyon springslakeside at mill creeklakeside at teserralakeside at tesseralakeside at tessera on lake travislakeside at the parklakeside beachlakeside developmentlakeside estates ph 1lakeside estates sec 02lakeside estates sec 3lakeside estates sec 4lakeside estates sec 5lakeside heightslakeside hills ph 03-alakeside hills sec onelakeside hills sec threelakeside hills sec twolakeside meadowslakeside passlakeside ph 1lakeside ph 2lakeside ph 3lakeside sublakeside sub sec 1lakeside university hillslakeside villas condominiumslakeside villas condos bldg 1lakeside villas iilakes of cypress forest sec 4lakes of northtown sec 01 amdlake terrace estateslake thunderbirdlake travis 01lake travis 02lake travis 03lake travis 05lake travis 06lake travis 07lake travis 09lake travis 17lake travis subdlake travis subd #1 final replatlake travis subd 9lake travis transitional mediclake valleylake valley estateslake vallleylake viewlakeviewlakeview 2ndlakeview acreslake view addlake view estateslakeview estateslakeview gardenslakeview heightslakeview hills sec 01lake view parklakeview park sublakeview park sub 2ndlakeview ranchlakeview subdivision 2nd replat (pt lakeview park & p1)lakeview sub sec ilakeview sub sec iilakeview unit 1lakeview villaslake vista ranchettelakewaylakeway condominium patio homes sec 1 amlakeway condo patio homelakeway estateslakeway highlandslakeway highlands (rough hollow)lakeway highlands ph 01 sec 01lakeway highlands ph 01 sec 02lakeway highlands ph 1 sec 3lakeway highlands ph 1 sec 7blakeway highlands ph 1 sec 8alakeway highlands ph 2 sec 1alakeway highlands ph 2 sec 1blakeway highlands ph 2 sec 2alakeway highlands ph 2 sec 3lakeway highlands ph 2 sec 4lakeway highlands rough hollowlakeway hlghlands rough hollowlakeway hlnds ph 1 sec 5lakeway hlnds ph 2 sec 7lakeway hlnds ph 3 sec 1lakeway lohmans crossing estlakeway m u d e-5 tanklakeway office park ilakeway sec 01lakeway sec 02lakeway sec 03lakeway sec 04lakeway sec 04-clakeway sec 05lakeway sec 06lakeway sec 07lakeway sec 08lakeway sec 8lakeway sec 9 & sec 13 first rlakeway sec 11lakeway sec 12lakeway sec 14lakeway sec 16lakeway sec 16-clakeway sec 17lakeway sec 20lakeway sec 22lakeway sec 22-alakeway sec 22-blakeway sec 23lakeway sec 24lakeway sec 24-blakeway sec 24-clakeway sec 26lakeway sec 26-c finallakeway sec 27lakeway sec 28lakeway sec 28-clakeway sec 29lakeway sec clusters 28 02lakeway sec clusters 28 04lakeway sec clusters 28 05lakeway sec clusters 28 vlakeway townhouses amendedlakeway twnhs amdlakeway twnhs sec 02 amdlakeway world of tennis condominiumslakeway world tennis condolakewind estates sec 03lake winds #2lakewoodlakewood condo amdlakewood country estate ph 1lakewood country estateslakewood estatelakewood estateslakewood estates #1lakewood estates #2lakewood estates 3lakewood estates sec 2lakewood forestlakewood forest i 02 & 03lakewood forest iiilakewood forest unit iiilakewood greenslakewood hillslakewood hills on canyon lake 1lakewood on park office condolakewood parklakewood ranches sec one rlakewood ranches sec twolakewood ranch ph ivlakewood ranch ph vilakewood sec 01lakewood sec 02 ph 01lakewood sec 03lakewood sec 04lakewood sec 04 amdlakewood sec 05-alakewood sec 05-blakewood shadowlakewood villagelakewood west at lakewood ranclamar point preservela marquelamar villagelamb & mohlelambert parklambie homes condolambies r c resub vossla mirage condominiumsla moraia estateslampasaslampasas oaks ilampasas river place ilampasas river place ph 2lampasas river place phase iilampasas river place phase twolamplight village sec 01lamplight village sec 02lamplight village sec 04lamplight village sec 05lamplight village sec 06lamplight village sec 3lamplight westlamplight west sec 02lana weeks sublancashire sublancaster estateslandlanda park estateslanda park highlandlanda park highlands 1landa park highlands 2landeralanding/heritage oakslanding/lakeway condoslanding at lakewaylandings/lk travis sec 1 & 2landings/lk travis secs 1 & 2landmark pointelandmark pointe - guadalupe countylandmark square condoland mart sublandon's crossinglandon ridgelandons crossingland part/the william nicholdslane a e addlangdonlangdon-unit 1langdon un 1lanier ranchlanier ranch add tr 01b-a 10 00 ac abst id s46lanier terrace sec 04lanier terrace sec 4lankfordlann surrlansdale 2lantanalantana homes add ph ilantana oakslantana ridgelantana sec 03lantana sec 04lantana single family sec 01lantana single family sec 02la palomala paloma subla perlala pointla pradera additionla prelle placela prelle place resubla pryorlarchmont cove condolarchmont placela reata ranchlaredolaredo sprgs unit 1laredo springs nelariatlariat - 70'lariat - 80'lariat sec 6lariat sec 7lariat sec 10lariat secs 3 & 4lariat secs 3 & 4 amdlark canyonlark canyon un 1lark canyon unit 1larkdale-oconnor subdlarkspurlarkspur / caughfieldlarkspur r4larry's harborlarry estateslarrys harbor add poclarry sunday acreslarson crossinglarson estateslaruela rue condo amdlas alamedaslas aldeaslasalle landing 02la salles landing sub ph ilas alturasla santa vidlas brisaslas brisas #1las brisas #3las brisas #8las brisas#10las brisas at ensenada shoreslas brisas estateslas brisas townhomeslas cimas sec 01las cimas sec 1las colinaslas colinas amdlas colinas at lake austin conlas colinas estates subdivisiolas colinas sublas encinaslas entradas on lake travislas estanciaslas estancias 2 sublas estanciasdlas estancias iilas estancias sublas fincaslas flores bus parklas haciendas twnhs condolas hadaslas lomaslas lomas sec 1 resubdlas lomas sec 2las lomitaslas montanaslas palmaslas palmas sub poclas palomaslas palomas country club estatelas palomas country club estateslas palomoas country club estlasseter h l addlas sombras condo nelastovica squarela terraza condo amdlatham, williamlattimorelaubachlaubach 2-alaubach 5laubach sub un 2alaubach sub un 2blaubach sub un 4alaubach sub un 4blaubach sub un 5laubach sub un 6laughinlaura heightslaura heights estateslaura heights pudlaurel canyonlaurel canyon ph 01laurel canyon ranchlaurel canyon subd u-1laurel creek ranchlaurel heightslaurel heights 2laurel hillslaurel mountain ranchlaurel rdg sec 06laurel ridgelaurel ridge sec 01laurel ridge sec 02laurel ridge sec 05laurel ridge sec 06laurels at legend oakslaurels at legend oaks ph 3 alaurel vistalaurel vistaslaurelwood estateslauren estatesla vacalavacalavaca bay placelavaca county school leaguelavaca historic districtla vega park ac annexla ventanala ventana ph 1la ventana ph 5la ventana ph 6la ventana ph 7la verniala vernia crossingla vernia estatesla vernia estates unrecla vernia estates unrecordedla vida facilla vid condo amdla vista de blanco riverla wardlaward farms 02lawlesslazy acreslazy diamondlazy diamond ranchetteslazy llazy lane villagelazy oakslazy river acreslazy valley countrylbjwf channellclc cunningham surv abs #221l d cooklea acresleachleach williamleague cityleakeyleakey hillsleakey springsleanderleander 61 ph 4leander 61 sec 1leander abstractsleander boardwalkleander crossing ph oneleander estatesleander estates ph 1leander heightsleander heights sec 01leander heights sec 01 amdleander heights sec 02leander heights sec 02 blk a lts 23 & 24 resuleander heights sec 02 repleander heights sec 03leander heights sec 03 resub lts 14 & 15 blkleander heights sec 03 resub lts 38 & 39 blkleander heights section 3leander heights sec twoleander hillsleander hills sec 02leander office condoleander transitional, williams - l50trleander williamson abstractsleander xing ph 1leasure addleavittledbetterledbetter & greathouseledgends hutto ph 04ledgends of rancho del lagoledger addledge resort condoledgerockledge stoneledouxs secondlee residential addleesvilleleesville farmslees wayleeward cove condole foster addnlegacy at lake dunlaplegacy at oak hilllegacy at oakhilllegacy at oakhill enclavelegacy at park meadowslegacy hillslegacy hills ph 2legacy homeslegacy oakslegacy pointlegacy ranchlegacy ranch phase 2legacy ranch phase iilegacy ranch ph ilegacy ranch ph iilegacy shoreslegacy trailslegacy trails iilegacy traisl 3b bl 17641legado estateslegallegal descriptionlegend@rancho del lagolegendary estates on lake lbjlegendary trailslegendary trails 45legendary trails 50legendary trls sub un 1legend heightslegend hillslegend oakslegend oaks addlegend oaks estateslegend oaks ph a sec 02legend oaks ph a sec 03blegend oaks ph a sec 05alegend oaks ph a sec 05blegend oaks phase onelegend oaks phs a sec 2legend oaks sec 07legend oaks sec 08legend oaks sec 1 or sec 2legend parklegend pointlegend pondlegend pond-legend meadow ph #legend pond-legend pointlegend pond-legend point ph #1legend pond-legend point ph #3legend pond-legend point ph #5legend pond legend mdw ph 4 sulegends at rancho del lagolegends hutto ph 02legends hutto ph 03legends hutto ph 04legends lane at onion creeklegends of huttolegends of hutto ph 4legends of hutto ph 5blegends rancho del lago 1legends rancho del lago 2legends rancho del lago 3legend subdlegends villagelegends village 2 residential condolegends village master condoslegends village office condolegends village sec 02 ph 01legends village sec 02 ph 02legends village sec 02 ph 04legends village sec 2 ph 4legends vlg 2 residential condlegends waylegends way at onion creeklegends way sec 1legends way sec 3legends way sec 5lehne ranchleisure acresleisurewoodleisurewoods #3 lot 5 blk bleisurewoods sec 2leisurewoods sec 4leisurewoods sec 5lemingleming townsitelemuel blakeylemuel kimbro surv #64lendalelengends of huttolenox condo amdlen schwertnerlen schwertner subdivision first extlen schwertner sub firlen schwertner sub foulen schwertner sub thilen schwertner third ext phleonaleona acresleona heightsleona irrigation & agricultureleona ranchleon blumleones sub unrecleon heightsleon river estatesleon springsleon springs villa mleon spring villasleon street condominiumsleon street condosleon valleyleon valley/canterfieldleon valley/grass valley subleon valley/shadow mist subdleon valley/sun valley subleo tuckerleralynn place condoleralynn place condominiumslerche subles chateaux condo ahlesikarleverence l, 2.356 acreslevi bostick league a 19levy comm first amendmenlevy corssinglevy crossinglevy townhomeslevy xinglewis, a.a. sur.lewis, jameslewis 3lewis addlewis farm estateslewis maylewis ranchlewis ranch 1lewis subdivisionlewis wlexingtonlexington at west boycelexington bus parklexington country estateslexington parkelexington parke sec 01lexington woodslhl i & flibertelibertyliberty addliberty hillliberty hill abstractsliberty hill ph iiliberty oaksliberty parkliberty park condo amdliberty parkeliberty parke ph 4liberty parke sub ph 1liberty parke sub ph 2liberty parke sub ph iiliberty placeliberty ranchliberty ranch tr 19liberty starliberty star subd phs 1liberty star subd phs 2liberty valley ph iliberty valley ph iiliberty valley ph iiiliberty villageliberty vly ph vlibrary office park condominiumslick creek ranch ph 01lick creek ranch ph 02 sec 01lieck estatesliendo, j.j.liendo c a moerbeliendo eggleston & kuecklerliendo thorndalelifschultzlighthouselighthouse country clublightsey 2's 2nd resublightsey 2s 2nd resublightsey rd condominiumslily springslime creeklimestone creek sub ph 1limestone ranchlimmer looplimpia crossinglincolnlincoln gardenslincoln gardens 01lincoln gardens no 1lincoln greenlincoln heightslincoln heights courlincoln heights townhomeslincoln lakelincoln lake estatelincoln lake estateslincoln lake farmslincoln parklincoln placelincoln ridge sublincolnshirelincolnshire/willow pklindalelinda ledgeslinda welch hawes add polindemann addlindemann additionlinden condoslindorbet ranch unrecordedlindseylindsey & harvey addlindsey & harvey addnlindsey place unit 1linea stillwaterlinks @ scenic hills unit #3 thelinks at canyon springslinks scenic hillslinkwoodlin luce ranches #1lin luce ranches #2lin luce ranches #3linn addlinnemann addlinscomb susie cater annexlinwood acreslinwood acres # 2linwood acres #2linwood acres #3lipscomblisa grace addlisa view acreslissolisso tr ph 1lisso tr ph 2little acreslittle bay shores #1little bird terracelittle elmlittle gabriel river estateslittle garnettlittle mcacreslittle piney creek estatelittle river academylitton, addisonlitton, johnlitton addisonlivelylively lane condominiumslively ph 1 sec 5lively ranchlively stone addlively stone addition phase 1lively tract ph 1 sec 3lively tr ph 2lively tr ph 3live oaklive oak acrelive oak acreslive oak acres 3live oak bayou acreslive oak estateslive oak estates replive oak estates sec 1live oak grove addlive oak grove addnlive oak hillslive oak hills sec iilive oak landing sublive oak lot 11live oak parkliveoak parklive oak park sec 2live oak ranchlive oak ranches sec 1live oak ranches sec 2live oak ranchettes unit iilive oak ranch sec 1live oak villagelive oak village jdlive oak village un 5livingstonl kl kimbro sur 64llllanollano crossingll bradshaw subllewelyn ranchetteslloyd maury allenl mercer abst & sandy harborlnloar add aloar addn alobits sublochwood estateslockett addlockhartlockhart acreslockhart byrdlockhill estlockhill est. rm'slockhill estateslocust streetlodge acreslodge acres annex 02lodges at lake clifflodges at lakeclifflodges at open acres ranchlodi groveloe additionloft condo amd thelofts/st stephens condoslofts/tuscan village bldg 3lofts at st stephens condoslofts at tuscan villagelofts at tuscan village thelogan addlogan ranchlogan ranch sec 01 rsb lts 66 & 67logsdon roy & e clohmans crossing estates sec 01lohmans crossing estates sec 02lohmans crossing estates sec 06lohmans crossing estates sec 07lohmans crossing estates sec 1lohmans crossing estates sec 2lohmans crossing estates sec 5lohmans crossing estates sec 6lohmans ford condololitaloma altaloma alta estatesloma arealoma area 1 edloma area 1a edloma area 2 (ed)loma area 2 edloma bellaloma bonitaloma fresaloma lindaloma mesaloma parkloma park heightslomas, llomas rodando south 1st extloma verdeloma verde 3loma vistaloma vista estatesloma vista estates amd ltloma vista estates ph fourloma vista estates ph threeloma vista estates ph twoloma vista ranchloma vista ranch ph 2lometalondonlone man mountain preservelone mesalone mesa ranchlone mountain ranchlone oaklone oak city of seguinlone oak condolone oak estateslone pine forestlonesome dovelonesome dove estateslonesome dove ph 5lonesome dove ph 6lonesome dove ranchlonesome dove sublonesome dove sub phaslonesome dove unit #1lonesome oak bus park residencelonesome valleylonesome valley sec 01lone starlone star, s durango/probandtlone star 2lonestar at alamo ranchlone stardlone tree acreslongbranch sec ilong canyonlong canyon 02-along canyon 02-blong canyon ph 01-along canyon ph 01-blong creeklong creek, ph #1long creek, ph #2along creek-the banditlong hollow estateslonghorn canyon condo amdlonghorn meadowslonghorn meadows #2longhorn ranchlonghorn sublonghorn valleylongmirelongridge heights sublongs creeklongs ridgelongviewlongview addlong view estateslongview iilongview ph 1lookout at brushy creeklookout blufflook out canyon creeklookout canyon creeklookout mountain westlookout ridgeloop 363 comm subdivisioloop condoloop condominiumloop condominiumsloopsy subloraine estatesloraloma thomas ranchlorenalorena otlori heightslorraine heightslorrielos altoslos altos village condo amdlos angeleslos angeles - keystonelos angeles-keystonelos angeles heightslos angeles heights/keystone historic districtlos angeles hts-central (sa)los angeles hts-central salos angeles hts/keystone historic districtlos angels keystonelos cazadores sublos cieloslos cielos sec 01los cielos sec 02los cielos sec 03los cielos sec 04los colinas of kerrvillelos encinos de paz finallos escondidoslos indios ph alos jardineslos milagroslos milagros, phase 1los milagros ph 1los milagros ph 2los milagros ph 3 sublos milagros ph 4 sublos milagros ph 5 sublos milagros ph 6 sublos milagros phase 3los pinoslos presidentes iilos ranchitoslos ranchoslos reyes canyonslos ricos pobrelos senderoslos senderos sublos suenos sublost acreslost acres estateslost addlost additionlost canyonlost canyon 2lost canyon ranch 02lost colony villaslost covelost creeklost creek addlost creek at gaines ranch replost creek hill toplost creek ranchlost creek sec 01lost creek sec 02lost echo baylost oakslost pineslost pines devlost pines developmentlost quarry add ph 1lost river rancheslost river ranches sec 02lost spgs sub sec 2lost springslost springs sub sec 2lost trails subdivisionlost valleylost valley hillslost valley shoreslost woods preserve ph 2los urdiales subdivisionlot 2 blk g south park sec 2lot 2 dinerstein addn block 2lot 3-5 block 51 crystal citylot 7 blk x avalon phs 5alot 26 blk n gilbert lane phs 3lot 51 & lot 52 old ferry subd sec 2lot 51 old ferry subd sec 2lot 105 imperial valley sec 1 amendedlottlott addlott sublou davis port lavacalouis ave site condoslouis condominiumslouiselouis koepsellouis ulrichlous garden subloveladylower frio estateslower guadalupe-rancheslower thirtylow meadowlow theodore heightslow water crossing on brushy creekloyolalplrm subdivisionl r taylor addl r williams business park phase iilr williams bus park ph 1lsl s c 01l s c 1stl s c1stl s c 2ndl t bosticklubbocklucchese villagelucchese village new city bl 16385luceroluciano cabasasluciano cabasos surv #3lucille st duplex subluckey ranchlucky ranchlufkinluke addnlula haywoodlulingluling southeastluma condoslumberyard loftsluna parklundlutheran church road addnlutterlohluxor ranchluxor ranch, lot 18, acres 3.11lwlydia glasgow survlyfordlymon f rounds surv abs #779lynch patricklynndale sec 02lynnhavenlynnhaven port lavacalynwood village enclavelyric condoslytlelytle-lytle park estlytle-san antonio s/d irrg farmslytle fc brucelytle ranchlytton hills ph 1lytton hollowm-m subm. e. chernosky subdm.h. surm. l reynam/r (s of 290)m5 subdivisionmamaas addmabankmacarthur parkmacarthur terracemacarthur terrace sub un 8-amacdonamacdona (sw)machacekmack digby submackenzie meadowsmackiemacmora acres resub amdmaddalena ranchmadera at cibolo canyonmadison, j cmadison heightsmadison j, cmadison ranchmadisonvillemadridmadronamadrona ridge banderamadrone canyonmadrone canyon ranchmadrone ranchmadrone ranch sec 02 amadronesmadsenmadsen ranchmager mdws ph 1mager mdws ph 3mager meadowsmager meadows ph 1magnoliamagnolia (sol-mlk) condominiumsmagnolia additionmagnolia condomagnolia creekmagnolia crk sec 2 amdmagnolia crk sec 3magnolia crossingmagnolia estatesmagnolia fig gardensmagnolia heightsmagnolia north enclavemagnolia spgs 1magnolia spgs 2magnolia spgs 5magnolia springsmagnolia subdivisionmagnolia villagemagnolia village northmaha creek estatesmahaffeymahanmahcke parkmahmckemahncke parkmahnckeparkmahncke park i samahonmailtrail valley ranchmainmainland oaksmainland squaremain street plazamajestic estatesmajestic estates sec 1majestic hillsmajestic hills ranchmajestic hills ranchettesmajestic hills ranch ph onemajestic hills ranch ph twomalaga condomalaga condo amdmaldonadomaldonado#1 aka samuels court#2malibu estatesmalish estatesmallard park ph 1mallard park ph 2m allenmallett addmallorys first addmallorys second addmalonemalone johnma murchisonmanana terrace lotsmanana terrace ltsmanana westmanchacamanchaca, a. surmanchaca estatesmanchaca estates amdmanchaca gardensmanlovemanning resmanning sub #1mann j wmanormanor commonsmanor creekmanor creek 1manor creek 4manor creek 5amanor heights ph 2 sec 1amanor heights ph 2 sec 1bmanor heights ph 3manor heights ph 3 sec 1manor heights ph 3 sec 2manor heights south ph 1 sec 1manor hillmanor hillsmanor hill sec 02manor hills sec 03manor hills sec 06manor hills sec 07manor original townmanor parkmanor terracemanor townmanor townhomesmanor town ofmanor villamanor villa estatesmansions eight65mansions of budamansolo submanuel marquez surv abs #84maple creekmaple creek condosmaple run sec 01maple run sec 02-amaple run sec 03maple run sec 04-amaple run sec 05-amaple run sec 06maple run sec 07-bmaple run sec 08maple run sec 09maple run sec 9maplesmaravillamaravillas subdivisionmaravillas westmarbach gardensmarbach placemarbach ridgemarbach village ut-5marbellamarbella sub ph 1marbella sub ph 2marbella sub ph iimarbella villas twnhms a condomarble creek crossingmarble fallsmarble falls citymarble falls ind parkmarc ritz plazamarfamargaret mcdaniel surv abs #44margaux court townhomesmariemont 1 port lavacamariemont submarigoldmarina village at lakewaymarina village at lakeway condomarionmarion parkmariposa parkmariposa sunday farmsmariposa terracemarkhillsmarlboro countrymarlboro heights resubmarlboro heights revmarlboro heights rev ltsmarlinmarlin azul villas submarlin pinemarlo heightsmarlo heights, section 2marlo heights sec 01marlton place sec 01marlton place sec 02marlton place sec 1m a rodriguez surmarquezmarroquin ph 2marrsmarshall's pointmarshall aransas creek ranchmarshall eliasmarshall ford vistamarshall meadowsmarshalls harbor / riviera at lake travismartmartha rogersmartinmartin's meadowmartin addmartindalemartindale heightsmartindale heights submartinez, augustinmartinez mmartinez sur 124martin james abs #259martin luther kingmartin rollinsmartinshaw resubmartin view submartin walkermart otmarvin 01marvin 02mary ann submary e mahonmary helenmarymontmary thomas survey, a-75maseles f c addmasonmason addmason avenue condominiumsmason clark additionmason creekmason creek estatesmason creek north sec 01 repmason creeknorth sec 1mason creek sec 01mason creek sec 02-amason creek sec 03-amason creek sec 04-amason creek sec 04-cmason crk north sec 1mason crk sec 01mason crk sec 03-amason crk sec 04-amasonfieldmason hillsmasonicmason ranchmason ranch ph 1 sec 1mason ranch ph 1 sec 2mason ranch ph 1 sec 3mason ranch ph 1 sec 6mason ranch ph 1 sec 7mason ranch ph 1 sec 7 & sec 8mason ranch ph 1 sec 9mason ranch ph 2 sec 1mason ranch ph 2 sec 2amatagordamatern islandmathias hirschpoldmathismathom landingmatthews & wilkes addmatthews parkmatthews park submatt hutzlermauck county linemaudmaverickmaverick creekmaverick lotmaverick ranchmaverick sharpmaverick springs ranmaxamillian, johnmaximo campos tr pt 40 a000maximo sanchezmaxwellmaxwell subdivisionmaya vistamayfairmayfair-pcl e-6mayfair imayfair iimayfair terracemayfair terrace ivmayfieldmayfield office parkmayfield ranchmayfield ranch sec 04mayfield ranch sec 08mayfield ranch sec 5mayo addmayo submayspring subdivision la vernia ranchesm barrera surmcmcallenmcarthur terracemcbryde acmccallmccampmccarty ranch ph onemccelveys addmcclain r wmcclain w bmccloud j surmccollum, eliasmccormick mountainmccormick mountain estatesmccormick mountain sub ph 2mccormick mountain sub ph 3mccormick ranch on lake austinmccormick ranch on lake austin phs 2mccoymccoy addmccrary tr sub un 12 countymccrelessmccreless meadowsmccrory submcdademcdade area 001mcdade citymcdaniel addmcdaniel parkmcdougalmcdougal jmcelroymcelroy addtionmcelwreath propertiesmcfarlandmcfarland estates first repmcgarmcginnis comm parkmcginnis comm park phmcglassonmcgregormcgregor estatesmcgregor otmcgregor spgs square addmcilvainmckay addmckeon, timothymckey, ruthmckey,ruthmckimbsmckinley heightsmckinley heights 02mckinley heights 03mckinley heights 04mckinneymckinney & williams survey, 16 acresmckinney & williams survey a-461mckinney crossingmckinney heightsmckinney park east sec 01mckinney park east sec 02mckinney park east sec 03 repmcleanmcnair parkmcnair park repmcnuttmcnutt r surm contis surmcqueenmcqueeneymcqueeney campmcqueen j surmcquown a nmcreynolds ranchmcsheperd ranches ridgeline ramcshepherd ranches brushy creem curvier surm de la garzameadormeadow acresmeadow acres 1st extmeadow acres 1st ext rep lmeadow acres 2nd ext rep lmeadow acres retreat addmeadow brookmeadowbrookmeadow brook estatesmeadowbrook estatesmeadow brook estates sec 3meadow brook jdmeadowbrook sec 01meadow cliffmeadowcliffmeadow commmeadow creekmeadow creek acres 517meadow creek estatemeadowcreek imeadow creek sec 01meadowcreek sec 02 ph 01meadowcreek sec 02 ph 02meadowfox estatesmeadow grovemeadow hillmeadowickemeadow lakemeadow lake heightsmeadow lake ph 01 02meadow lake ph 03 & 04meadow lake ph 03 & 04 amdmeadowlakesmeadow lake sec 01a amdmeadow lake sec 02 revmeadow lake sec 03meadow lake sec 06meadowlandsmeadowlark preservemeadowlark preserve ph 1meadowlawn addmeadowlawn addnmeadow mountain 03meadow mountain 04meadow oaksmeadow oaks northmeadow oaks ph imeadow oaks southmeadowood acresmeadowood northmeadow parkmeadow park sec 1ameadow park sec 2meadow park southmeadow pointe sub'dmeadow rdgmeadow ridgemeadowridge condo 2011meadowsmeadows/copperfield un 3meadows/martindalemeadows/mill crk un 1meadows/quick ranch condosmeadows @ nolte farmsmeadows @ nolte farms ph# 1 (the)meadows @ nolte farms ph 2meadows at berdoll ph 01 sec 01meadows at berdoll ph 1 sec 1meadows at berdoll ph 1 sec 2meadows at berdoll ph 2 sec 1meadows at bluebonnet hillmeadows at bluff spgsmeadows at bridgewoodmeadows at budameadows at buda sec 02meadows at cambridge heightsmeadows at cambridge heights pmeadows at chandler creekmeadows at chandler creek sec 01 rev blocmeadows at chandler creek sec 02meadows at chandler creek sec 03meadows at chandler creek sec 04meadows at clear forkmeadows at clear springsmeadows at copperasmeadows at double creekmeadows at kyle ph fourmeadows at kyle ph onemeadows at kyle ph twomeadows at oak creekmeadows at quick ranchmeadows at the reservemeadows at trinity crossingmeadows at trinity crossing phmeadows at trinity crossing ph 01-bmeadows blackhawk ph 01meadows blackhawk ph 02meadows blackhawk ph 03meadows blackhawk ph 05meadows blackhawk ph 06meadows brushy creekmeadows chandler creek sec 05meadows condo ph i amdmeadows georgetown ph 02meadows georgetown ph 03meadows nolte farms ph# 1meadows nolte farms ph# 1 tmeadows nolte farms ph# 2 tmeadows of anderson mill phase 2meadows of blackhawk phs 4meadows of carriage hillsmeadows of copperfieldmeadows of georgetown ph 01meadows of georgetown ph 02meadows of georgetown ph 04meadows of kylemeadows of martindalemeadows of mill creekmeadows of morningsidemeadows of morningside 1meadows of morningside 2meadows of morningside 6meadows of sonterrameadows of trimmiermeadows of walnut creek secmeadow springs estatesmeadows submeadows walnut creek sec 05meadow valleymeadowviewmeadow view estatesmeadow view estates mhpmeadow view parkmeadow villagemeadow village imeadow village iimeadow waymeadow white addmeadowwoodmeadow woods resubd 1 & 2meadow woods sec 2meandering debate addmeans 2medford, williammedical arts squaremedical center south condo amdmedical park townhomesmedical pkwymedinamedina crossingmedina crossing - villasmedina hills harbormedina isd rural hwy 90 west (ns/sw)medina lake centermedina lake estatesmedina lake ranchettesmedina landingmedina meadowsmedina meadows eastmedina mountain addmedina river ranchmedina river westmedina shoresmedina trailsmedina valley mh parkmedina verdemedina verde submedlin creek ph imedlin creek ranchmedlin creek ranch ph iiimedlin creek ranch ph ivmedlin creek ranch ph onemegan's landingmegan addmegans landingmegee add 01meggsmehar gardensmeishamelissa ranchmelrose terracememorial 1memorial heightsmenardmencaacamenchacamendel addmendez submendozamenefeemenger springsmercedesmercermercer condosmercer condossmercers preservemeredith-rollinsmeridianmeridian otmeridian sec a2 & b2meridian sec c ph 01meridian sec c ph 02meridian sec c ph 03meridian sec d ph 02meridian sec d ph 03meridian sec fmerz additionmesa @ turning stone - guadalupe countymesa at turning stonemesa condominiumsmesa condosmesa creekmesa del arroyomesa del nortemesa forestmesa forest addmesa grandemesa oaksmesa parkmesa park phs 3mesa park sec 01mesa park sec 02mesa park sec 04mesa park sec 06mesa park sec 1mesa park sec 2mesa rdg ph imesa rdg ph iimesa rdg sec 09mesa rdg sec 6 amd ph 2-amesa ridgemesa ridge sec 01mesa ridge sec 03mesa ridge sec 07mesa verdemesa verde acresmesa verde at skylinemesa verde at stone oakmesa verde estatesmesa verde nemesa verde texasmesa view ranchmesa villagemesa village condomesa village condo amdmesa village condominiums ammesa vistamesa vista estatesmesa vista ranchmesa vista ranch ph 1mesa vista ranch ph 2mesa vista ranch ph 3mesa westernmesetamesquitemesquite acresmesquite ridgemesquite trailmesquite westmesquite west phase twomesquite west ph imesquitewood estate iimesser,casa blanca,bosquez,newell,wright,compressmessinamessinger villagemexiameyer's lndg ph 2meyer 444meyer addmeyer addtion areameyer ranchmeyer ranch un 2meyer ranch un 4meyer ranch un 9meyer ranch un 10meyer ranch un 12meyers landingmeyers lndg ph 1meyers lndg ph 2meyersvillem f connellm g mmichael gillanmichael gillian surv 4 abs #10michaels fairview park 02michalek submichalk-wright addmicomid acresmiddle brook at santa rita ranchmiddle brook ranchmiddle brook sec 2middle creek crossingmiddletonmiddletownmidfieldmidfield original townsitemidlandmidlothianmidtown professional officemidway addmidway estatesmidway on babcockmiguel davila surv abs #8milago condo amdmilago condominiumsmilam grovemilam oaksmilam ranchmilam ranchesmilann placemilanomilburn addm i leal acreagemilestone southpark condominiumilestone southpark condominiummilfordmilford oaksmilky way/river place condosmillbrook/ladera hillsmillbrook/ladera hills ph-iimillbrook parkmillbrook park ph 1amillbrook park ph 2millbrook park ph 3mill creekmill creek courtyard homesmill creek courtyard villagemill creek crossindmill creek crossingmill creek crossing #1amill creek crossing #1bmill creek crossing #7mill creek crossing#11mill creek meadowsmill creek meadows phase iiimill creek meadows phase lllmill creek meadows ph iimillcreek ph 1millcreek ph 3mill creek ranchmill creek sec 1mill creek sec 3mill creek sec 4mill creek sec 7mill creek sec 9mill creek sec 10mill creek sec 11mill creek sec 12mill creek sec 14mill creek sec 15mill creek spgs pmill creek spgs ph iimill creek spgs ph ivmill creek spgs ph iv ammill creek spgs ph vmill crk mdws ph iiimill crk spgs ph ixmillermiller creekmiller creek ranchmiller crk ranch ph 2miller crk ranch ph 3miller hmiller ranchmillers pointmillers ridgemillers valleymiller valleymillett, samuelmillicanmillican, edwardmillican grovemilligan addmills creek ranchesmills creek ranches #1mills runmillview addmil runmilrun village at anderson millmiltenberger addmiltonmilton george jrmilton wells industmilwoodmilwood 35milwood sec 01 ph 01milwood sec 01 ph 02milwood sec 03milwood sec 04milwood sec 05milwood sec 06milwood sec 08milwood sec 09milwood sec 8milwood sec 9milwood sec 11milwood sec 12milwood sec 14milwood sec 15-amilwood sec 16milwood sec 17milwood sec 22milwood sec 23milwood sec 26amilwood sec 26bmilwood sec 27amilwood sec 27bmilwood sec 28milwood sec 29milwood sec 30 5milwood sec 30-cmilwood sec 30cmilwood sec 31amilwood sec 32a rep sec 32milwood sec 33amilwood sec 34milwood sec 35milwood sec 36milwood sec 37bmilwood sec 38amilwood sec 38bmilwood sec 40-amilwood sec 40amimosa manor sec 03mineralmineral heightsmineral springsminnie street condo 07mirabelmirabel park ph 1 easton park secmirabel park ph 1 sec 2cmirales b l ymiralomasmiralomas garden homes unit 1miramarmiramar submiramar unit 1mira monte twnhmsmiramont ph 09mira vista parkmira vista ph 2mircommiscoe estatesmissenberger addmissionmission creekmission del lagomissionesmissiones subd (sw)mission forestmission forest 1mission heightsmission hillmission hillsmission hills 1mission hill sec 02mission hill sec 03mission hills ranchmission hills ranch 1mission hills ranch 2mission hills ranch 5mission hills ranch 7amission oaksmission oaks 1mission oaks 4mission oaks 5mission oaks ph 1mission oaks ph 2mission oaks ph 3mission ridgemission ridge 2mission river oaksmission tracemission valley estates 1mission viejomisson hills ranchmisson viejomisty acresmisty acres 2misty creek ph iimisty hillsmisty meadowsmisty oaksmisty oaks estatesmisty oaks iimisty ridgemisty valley ph 1 trentomisty woodsmitchell, thomasmitchell estates 2mitchell farm ph 1mitchell farm ph imitchell farmsmitchell street condomi tierrami tierra submj flea markets addm j garcia survey aw0246m k & tmlkmlk-183 / east austin/ ribbecke avenue condominiumm lopasm m kenneym morenomobile city estatemobile home only cedar park ranchettes 04 blmobile villa esatesmockingbird acresmockingbird heightsmockingbird heights 4mockingbird hillmockingbird hillsmockingbird hill sec 01mockingbird hill sec 02mockingbird parkmockingbird pond condosmodern austinmoffat road addmoffat spgs iimohle addmokry & cameronmollys acresmonaco condomonaco condo amdmonaco condo amd.monaco estatesmonarch on mainmonarch ranchmonarch ranch/manor ph 1monica ranchmonkhouse estatesmonodmonroe, danielmonroe heightsmont-dalemontana ridgemont blancmontebellamontebella/ known as deer creek ranchmontebellomontebello condomontechino ph one sec onemontecitomonteolamonterey villagemonterrey hills submonterrey hills sub semonterrey villagemonte sagrado submontes de ocamonte verdemonte verde phase iimonte verde ph imonteverde un 4amonteverde un 4a enclavemonte viejomonte vistamontevistamontevista condomontevista condominium communitymontevista condominiumsmontevista condo ph 01montevista condo ph 01 amdmontevista condo ph 02 amdmontevista condo ph 03 amdmonte vista subdivision blk d lot 5, acres .5000.monte vista terracemontgomerymontgomery addmontgomery glenmontmontgomery gmmontgomery villagemonticello heightsmonticello parkmonticello park - ph 2monticello park historic (sa)monticello park historic samonticello ranchmonticello ranch subdmontopolismontopolis residential condominiumsmontview acresmonument hill - sec 3monument hilll - reserve a 623moodymoody otmooney vlgmoonlight condomoonridge submoonridge subdivisionmooremoore's crossingmoore-tate 4314 jinx condomoore d cmoore d c addmoore d c addnmoore estatesmoore farm blocks 446moore john h 445mooreland reservemoore lewismoore morrismoores addmoores crossingmoores crossing ph a sec 01moores parkmor acresmorado cove condo ph 02 amdmora j smoreno jmorganmorgan creek villagemorgan heightsmorgan meadowsmorgans heightsmorgans pointmorgans point resortmorgans point resort city secmorgans point resort sec 1morgans point resort sec 2morgans point resort sec 3morgans point resort sec 4morgans point resort sec 5morgans point resort sec 7morgans point resort sec 8morgans point resort sec 9morleymorning glenmorning glen rep lts 12-35morning mistmorning mist submorningsidemorningside acresmorningside add sec 02morningside estatesmorningside heightsmorningside meadows sec 01morningside meadows sec 05morningside meadows sec 07morningside parkmorningside pk/pan ammorningside trailsmorningside trails un 3amorning starmorningstarmorningstar - comalmorningstar ph 1 sec 2 submorningstar ph 1 sec 4bmorningstar ph 2 sec 1morningstar ph 2 sec 4 & 5morningstar ph 2 sec 4 5morningstar ph 3 4 sec 1 2 4morningstar ph 3 sec 2amorningstar ph 3 sec 2bmorningstar ph 3 sec 3morningstar ph 4 sec 3morningwood condo amdmorningwood sec 3morris & goodemorris & goode 2ndmorris, jonathan dmorris ranchmorris subdivision phase onemorris sub ph onemorris sub ph threemorris sub ph twomorrow addmorrow johnmorrow resubmorrwoods ranchmorse valleymorse valley addn phs 2morse valley addn phs 3morse valley addn phs 5morse valley addn phs 7morton m mccarver survmorton m mccarver surveymosaic residential north condomoses gage surv a-8moss brookmoss brook condomoss brook estatesmoss brook estates nmossbrook estates northmoss rosem otmoultonmoulton townsitemountain citymountain city oaks sec 3mountain creek 04mountain creek east ph a secmountain creek lakesmountain creek lakes sec 01mountain creek lakes sec 1mountain creek ranchmountain creek sec 01mountain creek sec 03mountain creek sec 1mountain creek submountain crest unit 1mountain crest unit 3mountain homemountain laurel addmountain laurel estmountain laurel estates 1mountain laurel ranchmountain lodgemountain lodge ut-5bmountain oaksmountain ranchmountain shadowmountain shadowsmountain shadows ranchmountain spgs ranch 1mountain spgs ranch 2mountain spgs ranch 3mountain springs ranmountain springs ranchmountain springs ranch 2mountaintopmountaintop add 3rd incmountaintop addn 3rd incmountaintop addn 4th incmountain valleymountain valley ranchmountain viewmountain view 2mountain view addnmountain view estatesmount arrowheadmount bonnell shores sec 02mount calmmount laurelmount lookoutmount lookout 1mount sharp airparkmount sharp ranchmourning dovemourning dove s submouth pedernales sec 02mp estatem rohuzmrs m m blanksm s z addmtmt lookout sub un 2mt martin surv abs a-963m tongatemt pleasantmuckermuculloch'smuehl road estatesmuellermueller fred amueller gmueller gateway submueller house condo amemueller housesmueller sec 04 amdmueller sec 05mueller sec 1-c ph1mueller sec 10mueller sec 10 a submueller sec 11mueller sec 11 submueller sec i-c ph 1 submueller sec ix sub amdmueller sec vii-c sub amdmueller sec vi submueller tc-1bmuldoonmuldoon league 14muldoon m #13 lgmuleshoe bendmullermullinmulti familymultiplemumme gardens subdivisionmunicipal drive townhomesm universitymurchisonmurphy addmurphys meadowmurray noredmurray placemusick estate submustang creekmustang crk ph 1mustang crk ph 4mustang crk ph 5mustang crosmustang estatesmustang hills ranchmustang island estatesmustang mesa- sec 1mustang mesa sec 01mustang mesa sec 02mustang oaksmustang ranchmustang ridgemustang ridge estatesmustang ridge estates sec 01mustang springs at saladomustang valleymustang valley estatesmustang valley sec fourmustang valley sec sixmustang valley submutual #1mutual lumberm ximenez surmyrtle fultonmystic bluffsmystic castlemystic castle (sherwood shores)mystic parkmystic ridgemystic ridge estatesmystic shoresmystic shores 1mystic shores 4mystic shores 6mystic shores 7mystic shores 8mystic shores 9mystic shores 10mystic shores 11mystic shores 13mystic shores 14mystic shores 15mystic shores 16mystic shores 17mystic shores 18mystic shores 19mystic shores 20mystic shores 21mystic shores unit 14nn-an. barcroft estatesn / an /an/ an/an/a, not in a subn/a sereno springsn/s bandera/scenic lp nsn15qn- liberty hill nom-impn15tr - liberty hill transitionaln ananacogdochesnacogdoches northnagel crossingnaked indiannaked indian reservationnameless hollow condo pnancy blakeynancy blakey surv abs #98nancy fergusonnapa oaksnarcissa placenashnash, francisnash creek ranchesnashwood addnatalianatalia acresnatalia isd out of townnatascosa colony farmsnathan historic districtnathaniel gocher one-thirdnathaniel hubbard survnathaniel moore surv abs #410nathans addnatiivonatiivo austinnatiivo austin, zoppp addnatiivo zoppp addnational bank add commercnativo austinnauertnauert addnauert addn 2nd extnauert addn 4th extnauert addn 5th extnauert addn 6th extnauert addn 7th extnauert addn 8th extnaumanns camp amdnaumanns pornavajo trail subdnavarronavarro, jose anavarro crossingnavarro fieldsnavarro j anavarro oaksnavarro oaks sub un 1navarro ranchnavarro sub un 1bnavarro sub un 1cnavarro sub un 2anavarro sub un 2bnavarro sub un 2cnavarro sub un 3bnavarro sub un 7navarro sub un icnavasotanbbnbhdnbhd0217nbhd code11410nbhd code15290nbhd code15530nbhd code15730n buckingham ridgencb 604ncb 1360 blk 1 lot 5ncb 2252 blk 3 lot 13ncb 2975ncb 6344ncb 8501 blk h lot 200g exc s e 17.18ftncb 10253ncb 10350ncb 13206 harmony hills sub unncb 16919ncb 17234 eckhert place condominiumsncb 17556 blk 6 lot 103ncb 18478 (tezel road ut-1) "guilbeau/fm 1604" annncb 18484 tezel oaks iiicncb 19095 blk 8 lot 53 (parkwood ut-2) "hausman/prncb a-18 2829nccisdnd addneneal tuttrup subneans place sec 01near eastsideneb lawardneedham estatesneedvilleneelys canyon condo amdneighborhoodneill mclean survey, abstract 325neimac add ph fivenelly condominiumsnelray place condo amdnelsonnelson subdivsionnelson village condosnemernew addnew additionnew braunfelsnew braunfels bl 4049new braunfels church/christ unnew braunfels hotelnew braunfels ranch estanew braunfels ranch estatesnew caneynew city bl 3537 city/san antonew clearnew clear #1newcombe estatesnewcombe ranch estatesnewcombe tennis ranchnewcombe tennis ranch 2bnewfield lane condo 2109newhavennew katynewman subnew s/d - tbdnewsom 2ndnew territoriesnew territories gdn hmsnewtonnewton & johnsonnewton & taylornewton addnew town lexingtonnew trail sub ph iinew ulmng boxn g stebbins surv abs #473n heightsnicholsnichols addnichols add 01 kenednichols additionnichols kellyniederwaldniederwald estatesniel brownnimmo, s. surnimmo sniswander burrownixonnixon blocksnixons ext/as shown/plat 33n kavanough turnersvin l camp addnono. 8nob hillnob hill #1nob hill condonoche/greenwood 2111 condosnockenut woodsnoconanoel mixonnoel mixon survey#23 abs#3nogalitos heightsnokonah condo amdnolan ridge ph 2nolan ridge ph 3nolanvillenolanville estates first replanolanville plaza undedicatedno le hacenolen addnolinanolina sub ph 1 sec 1nolina sub ph 1 sec 2nolte farmsnonanonenone (cedar hills)none.nopalitonopal valleynorchesternordheimnormannanorman placenorman place 1st ext repnorman place sub unitnormans add rep lt 1nortgatenorthnorth 10th addnorth acresnorth acres sec 01north acres sec 02north acres sec 03north alamo heightnorth alamo heightsnorthamptonnorthampton placenorth barcroft estatesnorth bellevuenorth bluffnorth bluff 3 condosnorth bluff condominiumsnorth bluff condosnorth bon airenorthcape sec 02northcape sec 03north castle hillsnorth cat creek trail condominiumsnorth cat mountain sec iinorthchasenorthcliffenorthcliffe #1northcliffe comm #1northcliffe ii unit 1northcliffe ph i first replnorthcliffe ph viinorth creeknorth creek east sec 01north creek east sec 1north creek sec 01north creek sec 02north creek sec 03anorth creek sec 03bnorth creek sec 03enorth creek sec 2north crestnorthcrest add ph twonorthcrest areanorthcrest estatesnorthcrest hillsnorthcrest subnorth crk sec iii-fnorthcross j sur mh serial unknorthdalenorth drive subnorth east centralnorth east centralecnortheast comm bus park sec 02northeast crossingnortheast crossing tif 2northeast crossing ut-15 tifnortheast devnortheast drive condominiumsnorth east parknortheast parknorth ellison ncb un 3northern heightsnorthern heights nenorthern hillsnorthern hills add 3rd extnorthern hills addn 2nd extnorthern hills addn 3rd extnorthern hills bl 16607 un 7northern hills ph 1northern hills phase 1northern hills ph iinorthern trailsnorthern trails, ph #1northern trails, ph #2northest crossingnorthfeildnorthfield addnorthfield addnnorthfield annex 02northfieldsnorth fields addnorthfields ph 1northfields ph 2northforknorth fork condonorth forty sec 2north gatenorthgatenorthgate addnorthgate additionnorthgate addnnorthgate add resub of lt 4 &northgate crossing condonorth gate ph iiinorth gate ph ivnorthgate ranchnorthgate ranch estates (estates at northgate)north georgetown addnorthhamptonnorth havennorth haven ph bnorth heightsnorth heights eastnorth hillnorth hill 447north hill additionnorth hills club twnhsnorth hills office park condomnorth hills subnorth hills villagenorth hwy 29north hyde parknorth i-10 - ind found prop 86north i-10 521northlakenorth lake estatesnorthlake hills sec 01northlake hills sec 02northlake hills sec 03northlake hills sec 05northlake hills sec 1 resub ofnorthlake hills sec 3northlake hills sec 3 resub ofnorth lake sec anorth lake sec bnorth lake sec cnorth lake sec dnorth lake sec enorthlake sec e resubnorth lake sec fnorth lakeway villagenorth lakeway village sec 03north lakeway village sec 06north lakewood sec 03north lakewood sec 04north lamarnorthlawn sec 01north lockhartnorth loopnorth loop terracenorth meadowsnorthmede sec 01northmoornorthmoor parknorth oaksnorth oaks hillside sec 01north oaks hillside sec 03north oaks sec 02north office park subnorth parknorthparknorth park 03north park estatesnorth park estates #1north park meadowsnorth park meadows 1north park meadows 4north park ph 03anorth park ph 04north park ph 1northpark ph 2bnorthpark ph 3anorthpark ph 5north park ph 6northpark ph 6northpark ph iii rep ltnorthpark ridgenorth park sec 01north park thnorth plainsnorth pointnorthpoint at old settlersnorth point ph 1north point ph inorth point quadplexesnorth ranch estatesnorth ranch estates #4north ridgenorthridgenorthridge 1northridge acres 02northridge parknorthridge park ncb 10428northridge park sec 01northridge park sec 02 ph a-1northridge ph 1northridge ph 3northridge terrace sec 02north rimnorth rim sec 02north san antonio hinorth shields sec 01north shoal creek estatesnorthshore/lk travis ph 1north shore colonynorthshore on lake travis, the hollowsnorthshore on lake travis phnorthshore on lake travis phs inorthshore ph 2bnorth shore ranchnorthsidenorth side addnorthside additionnorthside estatesnorthside mdw ph 2northside meadownorthside meadow ph 3north starnorth star hillsnorth star parknorth star sec 02north star sec 06north terracenorthtowne sec 01northtowne westnorthtowne west sec 01northtowne west sec 02northtowne west sec 05northtown parknorthtown park sec 01northtown park sec 02northtown park sec 04northtown park sec 05-anorthtown park sec 07northtown park sec 08northtown park sec 1northtown west sec 01north trails subnorth uvalde subdivisionnorthvale sec 3north valley prong ranchnorthviewnorthview, unit 3northview hills sec 03northview mobile homesnorth vista ranchnorthway crest sec 02northway crest sec 03northwestnorthwest acresnorthwest balcones amdnorthwest crossingnorthwest crossing 1northwest crossing 4northwest estatesnorthwest estates sec 02north west georgetownnorthwest hillsnorthwest hills 1st extnorthwest hills 3rd extnorthwest hills lakeview 03northwest hills mesa oaks phnorthwest hills mesa oaks ph 5-bnorthwest hills northwest oaksnorthwest hills oak ridgenorthwest hills ranch 1972 vainorthwest hills sec 02northwest hills sec 04northwest hills sec 06northwest hills sec 07northwest hills sec 6northwest hills sec 13northwest hills sec 14-cnorthwest parknorthwest ruralnorthwest rural/remains ns/mvnorthwest terrace sec 02northwest terrace sec 03northwest villagenorthwest village addnorthwest woodsnorthwind estatesnorthwoodnorthwood 03northwood 04northwood 05northwood acresnorthwood estatenorthwood gdn hms ahnorthwood hillsnorthwood hills un 1northwood northeastnorthwood oaksnorthwoodsnorthwoods at avery ranchnorthwoods avery stationnorthwoods avery station condonorthwoods avery station cottagesnorthwood sec 02northwood sec 06northwoods second repnorthwood terracenorthwood vnorthwood villagenorth zulchnorwalk square condonorwood v hno subdivisionnotapplicnot applicablenot a subdivisionnotgrass flatsnot in a defined subdivisionnot in definednot in defined subdivisionnottingham acresnotting hillnotting hill un-2novelnowlin heightsn pointe vista condo sansw clear creek add replanuckols condonueces corner condo amdnueces fallsnueces river ranchnueva vida 1-anunnridgenurserynwnw line torrey streetoo'farrelloakoakallaoak at twin creeksoak at twin creeks sec 02 theoak at twin creeks sec 03 theoak bendoak bend estatesoak bluffoak bluff estatesoak bluff estates 2oak bluff estates 3oak bluff estates phase 2oak brookoak brook sec 01oak brook sec 1oak brook sec 2aoak brook sec 2boak brook sec 3oak cliff acresoak cliff acres 2oak cliff estateoak cliff estatesoak colony estatesoak creekoak creek - newoak creek estatesoak creek estates ph 1aoak creek estates ph 1boak creek estates ph 3oakcreek northwestoak creek parke sec 02oak creek parke sec 04oak creek parke sec 05oak creek ph 2oak creek ph 3oak creek ph 4oak creek ph 5oak creek planned devoakcreek sec 01oakcreek sec 02oak creek suboak creek west sec twooak crestoakcrest estatesoakcrest estates unit 1oakcrest ranchettesoak crest ranchettes un 02oakcrest ranchettes unit 03oakcrest ranchettes unit 3oak daleoakdaleoakdale 1st unitoakdale 2nd unitoakdell manoroak fields estateoak forestoak forest add sec 01oak forest sec 02oak forest sec 04 amdoak forest sec 05-aoak forest sec 2oak forest villasoak forest westoak glen parkoak glen pk /castle pkoak groveoak grove estatesoak grove estates 1oak grove estates 3oak grove estates 4oak havenoakhavenoakhaven heightsoak haven sec 04oak heightsoak hideawayoak hidewayoak hill acres sec iioak hill addoak hill addnoakhill heightsoak hill heights sec 4oak hill ranchesoak hillsoak hills cntry cluboak hills devoak hills estsoak hills ranch estatesoak hills sec two ph onoak hills sec two ph twoak hills terraceoakhills terraceoakhills terrace - bexar countyoak hollowoak hollow estatesoak hollow parkoak hollow villageoak knolloak knoll condo amdoakland estatesoakland estates nsoakland heightsoakland pk suboaklands sec 01aoaklands sec 01boaklands sec 03a 03b & 02-revised amd plaoaklawnoaklawn addoaklawn addnoak lawn sec 01oak lawn sec 02oak manaor estatesoak manoroak meadowoak meadow estatesoak meadow retirement communityoak meadowsoak montoakmontoakmont downsoakmont estatesoakmont forestoakmont heightsoakmont heights annexoakmont heights annex 02oakmont heights annex 3 secoakmont heights annex no 3 sec 2oakmont suboakmont villageoak moss northoak mottsoak motts ranchettesoak mountoak orchard enclaveoak parkoak park additionoak park resub sec 02 & sec 03oak park sec 01oak plantationsoak pointoak rdgoak rdg ph 1oak rdg ph ioak rdg ph iioak retreatoak ridgeoakridgeoak ridge addnoak ridge estatesoak ridge estates lots 1-2 167 ac goak ridge estates sec 1oak ridge heights sec 01oak ridge heights sec 01 resuboak ridge heights sec 03oak ridge northoakridge parkoakridge park 1st unitoak ridge park at kinnicinik sec 2oakridge park at kinnicinik sec 2oakridge park sec 3oakridge park section 2 at kinnikinikoakridge pointeoakridge point nsoak ridge sec 01oak ridge sec 03oak ridge sec 1oak ridge sec 2oak ridge sec 3aoakridge terrace sec 1oakridge terrace sec 2oak ridge villageoak ridge villas townhomes condosoak ridge villas twnhmsoak runoak run 5boak run 8oak run 10oak run 16oak run 17oak run estatesoaksoaks/lakeline station condosoaks/san gabriel sec 2oaks/san gabriel sec 6oaks/san gabriel sec 7oaks/san gabriel sec 8oaks/san gabriel sec 9oaks/san gabriel sec 10oaks/san gabriel sec 13oaks/san gabriel sec 15oaks/san gabriel sec one boaks/san gabriel secs 11 & 12oaks/san gabriel sec twooaks/wildwood condooaks/wilwood condooaks 06 twentyoaks 2 theoaks 11 theoaks addoaks additionoaks at dial ike condo neisdoaks at highland lake estatesoaks at highland lake estatespoaks at lakeline stationoaks at san gabrieloaks at san gabriel sec 7oaks at sonterraoaks at spicewoodoaks at wildwood condooaks bartonoaks estates sec 4oak shadows condooak shoresoak shores estatesoak shores on lake austin secoaks northoaks of bentwoodoaks of french creekoaks of riverhilloaks of westcreekoak spgs #1oak spgs rep ofoaks ph 03oak springsoak terraceoak trail estatesoak trailsoak tree estatesoak valleyoak valley park sec 03oak valley subdivision phase iiioak valley sub ph ioak valley sub ph soak viewoak view acresoakview addoakview annex addoakview annex addn, block d, lot 1-3oakview condooak view heightsoakview heightsoak view ranchoak view ranch tr 1oak villageoak village northoak village north 2oakvilleoak vistaoakwateroakwater suboakwater subdoakwell farmsoakwoodoakwood acresoakwood condooakwood estatesoakwood estates 1oakwood estates 5oakwood estates 16oakwood estates 18oakwood estates 19oakwood glen southoakwood glen suboakwood heightsoakwood hillsoakwood hills unrecoakwood hollow condo amdoakwoodsoakwoods 1stoasisoasis lake dunlapoasis subdivisono a thompson surv abs 356oatoutocampo cocean reefocean reef cottagesocean view estatesoclr acresodemodessaodonnel hillsoelkers acresoelkers acres 2o e metcalfoglesbyogletree gogletree gapogletree gap loccd:100 sharedaoil city addoil city additionoil millokie heightsoklahoma addold 32old 32 ranchold 32 ranch 2old 440 villageold bandera road estatesold bee caves estatesold castle hill condo amdold coach estatesold enfieldold farmold farm communityold farm rd communityold fitzhugh twnhmsoldham addold lexingtonold lexington road acresold martindale roadold martindale roaddold millold mill crossingold mill resortold mill resort at grueneold mill resort condominiumsold mill tu56old mill villageold mill xing twnhms bldg 14old plum trinityold post road addold rockportold rose gardenscold settlers park ph 1old settlers park ph 3old townold town/lamarold town condo rev 1998old town eastold town gtown class h4 & h5old town lexingtonold town mdwsold town round rockold town sabinalold town village sec 02bold town village sec 03old trails estateold trails estatesold victoriaold west trailoleander heightsolguin estatesolive grove suboliveroliver & caseyoliver rancholiver ranch subolivia grantolling hillsolmosolmos/san pedro place saolmos parkolmos park gdnsolmos park terraceolmos pk terr historicolmos placeolson rancholt 32&33 div b glenwood addnolt 38&43 div a buratti & chericooltmann parent first troltorf village sec 2olympiaolympia estatesolympia heightsolympia oaksolympic heights sec 01olympic heights sec 02olympic heights westomega ranch ph 1omega ranch ph 2 northomega ranch ph 2 south mud #23onalaskaoncken-sheppard lane subone barton place condoone north placeone oakone oak bouldin creek condominiumsone oak condominiumsone oak condosone onion creek condo amdone river pointone tower park ln saoneyon fileonion creekonion creek addonion creek drive estateonion creek estates ph 6onion creek estates ph threonion creek estates ph twoonion creek meadowsonion creek ranch subonion creek sec 02 amdonion creek sec 03onion creek sec 04-donion creek sec 05-aonion creek sec 05-bonion creek sec 06-aonion creek sec 5-aonion creek village sec 01onion creek village sec 03onion creek village sec 1on target business parkopalopal meadowsopal ranchorangeorange groveorange grove condo amdorange tree condoorange tree condominia amdorange tree condominia amendorange tree condominia amended theorange tree condominiumorchardorchard condoorchard parkorchard park 1orchard ridgeoreilly jamesoriginal bertramoriginal cityoriginal city/round rockoriginal city of austinoriginal four league range 3original townoriginal town - rdoriginal town- roadoriginal town- thoriginal town/killeenoriginal town copperas cooriginal town of budaoriginal town of kyleoriginal town of san marcosoriginal town rallsoriginal townsite of chiltonorig town c-cityoro creek at vance jacksonoro de coronadoo roos addorsakorsinger laneortiz, joseorts acresosborn, mrs bo s maters sur a-550ot giddingsotherothersotis g eels survo t lockharto t lulingot lulingo t prairie leao t tilley addotts addotts additionoutout/out/aransas countyout/ atascosaout/atascosaout/atascosa coout/atascosa co.out/banderaout/bandera co.out/bastropout/bastrop countyout/beeout/bee countyout/bellout/bell countyout/ bexarout/bexarout/blancoout/blanco co.out/burnet countyout/ caldwell countyout/caldwell countyout/calhoun countyout/cameron countyout/comalout/comal countyout/comfortout/converseout/coryellout/ dallas countyout/dewitt countyout/dimmit countyout/duval countyout/edwards coout/edwards countyout/ ellis countyout/fayetteout/frioout/frio countyout/galvestonout/galveston countyout/gillespieout/gillespie countyout/goliadout/goliad ctyout/ gonzalesout/gonzalesout/gonzales countyout/grimes countyout/guadalupeout/guadalupe co.out/harrisout/harris countyout/haysout/hays coout/hidalgoout/hidalgo countyout/jacksonout/jeff davis countyout/ jim wellsout/jim wellsout/ karnesout/karnesout/karnes countyout/kendallout/kendall co.out/kerrout/kerr countyout/kimble countyout/kinneyout/kinney co.out/lampasas countyout/laredoout/la salle countyout/lavacaout/limestoneout/ live oakout/live oakout/llanoout/llano countyout/masonout/maverickout/maverick countyout/medinaout/menard countyout/montgomeryout/ nuecesout/nuecesout/nueces countyout/nueces gardens and suburbanout/realout/real countyout/refugioout / san patricioout/san patricioout/ san patricio countyout/san patricio countyout/taylorout/tom greenout/travisout/uvaldeout/uvalde co.out/val verde countyout/ wallerout/webbout/webb countyout/williamson countyout/wilson coout/zapataout/zavalaout/zavala countyout kerroutlot divisionout medinaout of areaout of atascosaout of county/see reout of county cameronout of nueces co.out of sa/bexar co.out of stateoverlook/saladooverlook @ the river crossingoverlook at boerneoverlook at canyon lakeoverlook at cat mountain sec 2overlook at cielo-ranchoverlook at creeksideoverlook at creekside unit 1overlook at creekside unit 2overlook at medio creekoverlook at medio creek ut-1overlook at medio creek ut-2overlook at pedernalesoverlook at river placeoverlook at saladooverlook at weiroverlook at west lake second aoverlook condooverlook condominiums theoverlook crystal fallsoverlook estates ph 01overlook estates sec 2overlook on bee creek theoverlook ranchoverlook villa northoverlook villa west amdoverture addowenowen, h. sur.owen acres sec 03owen parkowens 01owens murrayowl creek estatesoxbowoxbow/guadalupe suboxbow estatesoxbow on the guadalupeoxbow trails sec 1oxford place condoozonapablo martinezpace gideonpaceline addpacksaddle viewpaddock condominiums thepadre beachpadre beach subpadre islandpaekside condospaggi house subpaigepaige acrespaint creek iipainted buntingpainted bunting ph 02painted rock subpalace heightspalace heights 2palace heights 3palace heights 6palace heights 7palace heights 8palaciospalacios original townsitepaleface homesteadpaleface lake country estatespaleface park ph i sec bpaleface pedernalespaleface ranchpaleface ranch sec 01paleface ranch sec 02apaleface ranch sec 02bpaleface ranch sec 03paleface ranch sec 2bpalestinepalladian condopallatium villaspalmapalm condos bldg lpalm condo thepalmera bluffpalmera bluff sec 6palmera rdg condospalmera rdg sec 2palmera rdg sec 3palmera ridgepalmera ridge 80spalmer heightspalmer placepalmer ridgepalmer s sur tr akapalmetto condopalmetto condominiumspalm heightspalmilla beachpalmira/thepalm lakepalm parkpalm terracepalm west applehead villas ppalo altopalo alto heightspalo alto pointepalo alto terracepalo alto villagepalo blancopalomapaloma lakepaloma lake sec 06paloma lake sec 1apaloma lake sec 1bpaloma lake sec 3apaloma lake sec 4apaloma lake sec 4bpaloma lake sec 5paloma lake sec 7bpaloma lake sec 8paloma lake sec 10paloma lake sec 11paloma lake sec 12paloma lake sec 13paloma lake sec 16paloma lake sec 17apaloma lake sec 17bpaloma lake sec 18paloma lake sec 20apaloma lake sec 21paloma lake sec 23apaloma lake sec 24paloma lake sec 25paloma parkpaloma ranchpaloma subpaloma unit 5apaloma vistapaloma vista subpalominopalomino condospamela heightspan ampandalepankau parkpannell placepanorama-southpanorama ranch sec 01panoramic hillspanoramic hills resub tr 11panoramic hills rev of a ppanoramic hills subpanther commercial parkpanther creekpanther creek at stone opanther creek estatesparadise/guadalupe un 1paradise/guadalupe un 2paradise cove aptsparadise heightsparadise hillsparadise hills sec 03paradise hills sec 2paradise hills sec 3paradise manorparadise manor sec 04paradise on the guadalupeparadise on the guadalupe 2paradise pointparadiso villas condoparadocs retreatparaisoparamontparamountparamount sec oneparamount sec threeparamount section oneparamount sec twoparapet condoparapet condominiums theparco estates sec 01paris estatesparkpark/51 east condospark/blachawk 4 ph 7bpark/blackhawk 6 sec 5park/blackhawk iv ph 1park/blackhawk iv ph 3park/blackhawk iv ph 4apark/blackhawk vii sec 2park/blackhawk vi sec 3park/blackhawk vi sec 5park/wellspoint condopark 10 condo amdpark 21park @ vista del norpark addpark addition subdivisionpark at 51 eastpark at battle bend amdpark at blackhawkpark at blackhawk 02 ph 01park at blackhawk 02 ph 2bpark at blackhawk 02 ph 2bpark at blackhawk 06 sec 01 thepark at blackhawk 4park at blackhawk and lakesidepark at blackhawk iv ph 6apark at blackhawk sec 01park at blackhawk sec 02park at blackhawk sec 03park at blackhawk sec 04park at blackhawk sec 05park at blackhawk vi phs 4park at blackhawk vi sec 1 thepark at brushy creekpark at brushy creek ph 01park at del curto condopark at french creekpark at legends villagepark at quail creek amdpark at quail creek sec 02park at quail creek sec 2 thpark at spicewood spgs phpark at vista del nortepark at wellspointpark at woodlakepark at woodland oakspark ave condospark avenue condominiumspark centralpark creekside #2 theparkcrestparkdalepark eastpark east condominiumspark east condos bldg 3park east condos bldg 10parke at anderson millparke at travis country condomparkerparker creek ranchparker creek ranch parker stationparker heights sec 04parker placeparker square condoparker stationparker station 40sparke sec 05park estates sec 1park forestpark forest sec 01park forest sec 02park forest sec 03park forest sec 04park forest sec 05park forest sec 06park forest sec 07park forest sec 2park grove square addpark heightspark hillparkhillpark hill commonsparkinson place 01parkinson place resub 1parklandsparklands #1parklands theparkland villagepark lane estatespark meadowspark meadows addpark meadows add ph 1-cparkmoorparkmoore placepark mountainpark northpark north /old farmpark north/old farmpark north condospark north ph ipark north ph iipark oaks ph 1 rsbpark olympiapark placepark place 01park place at heatherwildpark place at old millpark place at old mill condopark place at riversidepark place at riverside amdpark place condopark place condo 06 12park place condominiumspark place ph 03 amdpark place ph 2park place ph 3park place phase ii u-1park place sec 02park place sec 1park place sec 2park ridgepark ridge 1park ridge estatesparkridge gardensparkridge greenpark ridge subdparks at westfieldparks at westhavenparksideparkside/mayfield ranch sec 02parkside/mayfield ranch sec 8parkside/mayfield ranch sec 9parkside/mayfield ranch sec 15parkside/mueller condoparkside/mueller condosparkside/river ph 1aparkside/river ph 2 sec 1parkside/river ph 2 sec 2parkside/river ph 2 sec 4 & 7parkside/river ph 2 secs 5 & 6parkside/river ph 3 sec 4 & 7aparkside/river ph 3 sec 5parkside/river ph 3 secs 3a &parkside addn phs 2 sec 1parkside addn phs 2 sec 2parkside at mayfield ranchparkside at mayfield ranch sec 01parkside at mayfield ranch sec 02parkside at mayfield ranch sec 9parkside at mayfield ranch sec 10parkside at northtown condominparkside at northtown condominiumsparkside at slaughter creek separkside condosparkside crossingparkside crossing townhomesparkside of the riverparkside on the riverparkside on the river - westparkside on the river 70sparkside on the river westparkside peninsulaparkside peninsula secs 1 & 2parkside subparkside un #3parkton squarepark viewparkviewpark view addpark view addnparkview add ph iparkview estatesparkview estates sec 1park villagepark village sub un 4park village sub un 8parkwayparkway place condominiums amended theparkway rsb lt 01 blks a-d &park west at circle c ph 02park west condopark west condominium residencespark west condo residencepark west condosparkwest estatesparkwest estates sec 1parkwest estates sec 2parkwoodparkwood ranchparkwood sec 02parkwood sec 03parkwood villageparmanparmerparmer condo 11901parmer crossingparmer crossing condoparmer lane heights sec 01parmer parkparmer placeparmer ranchparmer ranch 60parmer ranch ph 1parmer ranch ph 2 3 4 & 17parmer ranch ph 5a & 6parmer ranch phase 1parmer ranch phase 2parmer ranch phs 2 3 4 & 17parmer villageparmer village condoparmer village condosparmer village townhome condoparmer village twnhm condos bldg 1parmer village twnhm condos bldg 2parmer xing condosparris smith surv a-300parsons estates subparsons sec 03parsons subd sec 3partenparten: 65ft. lotsparten: oakridge parkparten ranchparten ranch ph 1parten ranch ph 4parten ranch ph 5parten ranch ph 6 & 7partridge amdpasadena heightsp a smith surv abs #415paso fino meadowspaso roblespaso robles ph 2bpaso robles ph 4b-2paso robles ph 4epate addpatiencepatriot's ridgepatriot ranches unit onepatriots rdgpatriot subpatterson add ph onepatterson c g addpatterson creek estatespatterson heightspatterson place on crystal creekpatterson ranchpatterson ranch ph ipattonpatton heightspatton ranchpatton ranchespatton ranch estatespaul jubelapaul matthews addpavona placepavona place sub un 2pawneepayne indust park sec 2peabody placepeabody plaza sec 2peace vly harbor 01peach creekpeach creek forestpeach creek forest 03peach grovepeak at promontorypea rdg ph 1pea rdg ph ipearlandpearl at 22 01 02 condopearl district townhomespearl street condo ph 01pearsallpearsonpearson i hpearson placepearson place add sec 2pearson place at avery ranchpearson place enclavepearson place enclave condospearson place sec 1pearson place sec 2pearson place sec 3pearson place sec 4pearson place sec 7pearson s c j pearson surpease frankpease frank epease place condopebble beachpebble brookpebble forestpebble ridge estatepecanpecan acrespecan arborpecan arbor 1pecan bottoms on lake austinpecan branchpecan branch estatespecan covepecan cove #1pecan creekpecan creek condopecan creek estpecan creek estatespecan creek ranchpecan creek south phase iipecan creek subdivisionpecan crk ph 5pecan crk south ph 2pecan crk south ph iipecan crk south ph iiipecan crossingpecan flex condospecan gardenpecan grovepecan grove bastrop copecan hillpecan hollow ranchespecan lakes estates ph 3pecan meadow subpecan orchardpecan parkpecan park #2pecan park garden estatespecan park residential secpecan park sec 1bpecan park sec 3cpecan park sec 3dpecan park sec 7pecan park section 2pecan ridgepecan spring ranchpecan springspecan springs springdalepecan square condopecan terracepecan unit 3pecan valleypecan valley estatespecan valley heightspecan valley ivpecan valley ph iiipecan vlypecan vly-fairlawnpecan vly-fairlawnsa/ecpecan walk condopecan walk condominiums thepeck, nathanielpeck r hpeck rhpecospecos estates condo amdpedernalespedernales 02pedernales bendpedernales canyonpedernales canyon ranch ph 01pedernales canyon ranch ph 02pedernales condo amdpedernales hills ranchpedernales placepedernales ranch estatespedernales viewspedreguerpedro gonzalespeggy adair addpeggy brown abstractpemberton heightspemberton heights sec 01pemberton heights sec 02pemberton heights sec 08pemberton heights sec 10pembroke forestpembroke villagependingpenelopepenick placepeninsulapeninsula at mystic shorespeninsula at mystic shores 1peninsula at mystic shores 3peninsula at mystic shores 4peninsula mystic shores 1peninsula on lake buchananpeninsula point/richland chambpenley parkpenley park ph 1penley park ph 3pennington placepenn place cottagespennsylvania avenue condominiumspenthouse condopenthouse condominiumspepper creek crossingpeppergrasspeppergrass ph 1cpeppergrass ph 2pepperidgepepper mill ph 3pepper mill sub ph 1peppertree park sec 01peppertree park sec 02peppertree park sec 03peppertree park sec 04-apeppertree park sec 05peppertree park sec 08perdido pointe estatesperez isabelperkins park sec 1perkins tr 1perlitzpernitas point 1perryperry & williamsperry, c rperrys white cliffperserve at mayfield ranchpershall subpershing placepershing place 1apershing place 3rdpershing place 5thpershing place 6thpersimmonpersimmon hillpersimmon pointpersimmons creekpersimmon spgs ph 1persimmon spgs ph 2persimmon springspersimmon springs phase threepeter fox surv abs #111peter k bartleson surv abs # 8peter kerr donationpeter kerr porpeter patepeters addpetersonpeterson addpettuspettytown rdpeyton placepfpfairway parkpfeifer paul addpfeifferpfeil acrespfennig placepfluger ernest addpflugervillepflugerville acres 02 ph 01pflugerville animal hospital & office developmentpflugerville estates sec 02-apflugerville estates sec 03pflugerville northwest sec 02pfullmann addpfullmann additionph178153apharo condopharrpharrassphase 1 amended the covephd llc addpheasant creekpheasant ridgepheasant run sec 01pheasant run sec 01-apheasant run sec 02philander priestlyphilip a smith league surv #26philip a smith surveyphillip a smith surveyphillip j allenphillipspiazza navona condopicadilly estatespicadilly ridgepicadilly ridge ph 01 sec 01picadilly ridge ph 01 sec 03picadilly ridge ph 03 sec 03pickettpickle clarapid# 191241piedmontpierce courtpietzsch 01pietzsch 02pilgrim rdg addpilot's landingpilot knobpilot knob acrespilots landingpine cove estatespinecrest s/d lot 24 1.23pine forestpine forest unit 06 ph 02pine forest unit 6 ph ipine forest unit 6 ph iipine forest unit 7 ph iiipine forest unit 8 ph iiipine forest unit 9 ph iiipine forest unit 10 p iiipine forest unit 12 p iiipine hil estates section 2pine hill estatespinehollowpine junction northpine oak estatespine ridge farmspine valleypine valley estatespine view estatespiney creek bendpiney creek bend, sec onepiney creek subpiney crk bend ph 2-apiney point sec 01piney ridgepinnaclepinnacle at cottonwood creekpinnacle at great hillspinnacle at north lakeway condopinnacle at oak hillspinnacle at oak hills condospinnacle ph 01pinnacle ph 02pinnacle ph 3pinnacle ph 4pinnacle ridge estatespinnacle thepinnelli-mayberrypinnelli-mayberry subpin oak estatespinon creekpioneer crossingpioneer crossing eastpioneer crossing east sec 04pioneer crossing east sec 05pioneer crossing east sec 06pioneer crossing east sec 07pioneer crossing east sec 09pioneer crossing east sec 18pioneer crossing ph 01pioneer crossing ph 03pioneer crossing westpioneer crossing west sec 02pioneer crossing west sec 04pioneer crossing west sec 07pioneer crossing west sec 3 ampioneer crossing west sec 8apioneer crossing west sec 9apioneer crossing west sec 9bpioneer crossing west sec 11pioneer estatespioneer hillpioneer hill sec 1pioneer hill sec 3pioneer hill sec 4pioneer hill sec 5pioneer hill sec 6pioneer passpioneer pines farmpioneer pointpioneer point condospioneer point subpioneer ranchpioneer ranch sec 1pioneer ranch sec 2pioneer xing east sec 3bpioneer xing east sec 17pioneer xing west sec 03pipe creekpipers meadowpipers meadow 1pipers meadow ipipkin addpipkin add 02pipkin add 04pirates cove condo pocpittspittsburgpitts levipj allen league abs #1p j lawless add division aplacedoplacidenaplacid heightsplacid parkplacid valleyplainview heightsplainview heights resubplantationplantation acresplantation heightsplantation oaks subplantation sec 02 rep blk b lts 15-24plantersvilleplasied b mccearleyplat/zavala subplatten creekplaymoor townhomesplaza lofts condo amdplaza placeplaza twnhms at avery ranch condoplaza vplaza ventura 02pleasant acrespleasant coxpleasant grove addpleasant grove estates ph 1pleasant hill addpleasant oakspleasantonpleasanton-benadale blk 5 lot 4bpleasanton-bensdalepleasanton- bowenpleasanton-cookpleasanton-cook - atascosapleasanton-franklinpleasanton-harlpleasanton-harl addpleasanton-harl addnpleasanton-high meadowspleasanton-honeyhillpleasanton-milcopleasanton-millspleasanton-north pleasantonpleasanton-oak haven s/dpleasanton-oaklawnpleasanton-originalpleasanton-r c fechner addpleasanton-sunnyfieldpleasanton-west oaklawnpleasanton farmspleasanton meadowspleasanton meadows-eventidepleasanton meadowswpleasanton ranchpleasant valleypleasant valley ranchespleasant valley sec 01pleasant valley sec 02pleasant view addpleasant view addnplumplum creekplum creek northplum creek ph 01 sec 01 aplum creek ph 01 sec 02 eplum creek ph 1 sec 1cplum creek ph 1 sec 1fplum creek ph 1 sec 2-aplum creek ph 1 sec 2cplum creek ph 1 sec 2fplum creek ph 1 sec 2gplum creek ph 1 sec 2hplum creek ph 1 sec 4plum creek ph 1 sec 6e2-3plum creek ph 1 sec 6h- 1plum creek ph 1 sec 6h-2plum creek ph 2 sec 1plum creek ph 2 sec 2plum creek ph 2 sec 3plum creek ph 2 sec 4aplum creek ph 2 sec 4bplum creek ph i sec 1-aplum creek ph i sec 1-bplum creek ph i sec 2-bplum creek ph i sec 2-eplum creek ph i sec 2dplum creek ph i sec 2jplum creek ph i sec 3bplum creek ph i sec 5a repplum creek ph i sec 6b-3plum creek ph i sec 6cplum creek ph i sec 6dplum creek ph i sec 6e2-1plum creek ph i sec 6e3plummer secpoapoc condo pocpoehlmann acrespointpoint at flatrock creekpoint at lake mcqueeneypoint at rancho del lagopoint bluff at rogers ranchpoint breezepoint comfortpoint comfort first addpoint comfort villagepointepointe 360pointe 360 condominiumspointe 360 condospointe condo amdpointe condominiums amendedpointe condominiums amended thepointe west nspoint lake mcqueeney thepoint northpoint pedernalespoint rancho del lago 1point rancho del lago 2point rancho del lago 3point rancho del lago 4point rancho del lago 5point tesoropoint venturepoint venture 02 sec 01point venture highpoint townhomespoint venture sec-2point venture sec 01point venture sec 01-bpoint venture sec 02point venture sec 02-apoint venture sec 02-bpoint venture sec 02-cpoint venture sec 03-1point venture sec 03-1-apoint venture sec 03-1-bpoint venture sec 03-2point venture sec 1 amd opoint venture sec 2-bpoint vista sec 03-apoint vista sec 04-apoint west of westover hills spoint west westover hillspolis additionpolo club at rooster spgs ph 02pomona park subdivisionponderosa homesteadpond hill garden villas ltdpond spgs office condopontotocpontotoc duplexes filling # 1poole place sec 1pope bend 2 subpope bend river estatespopespopes resubpoplar place condo saport altoport alto boat stallsport alto ranchettesport alto unit twoport aransasport bolivarporter & greenporter countryporter country ph 1porter heightsporter subdporticosport isabelportlandportland-northshore #2port lavacaport lavaca original townsiteport mansfieldport o'connorport o connorport oconnorport o connor outletsport oconnor townsiteportofinaporto villageoports o callports ocallport southposada del rey condo amdposk oak condopost oakpost oak condopostoake - post oak eastpost oak estatespost oak ph 01post oak ph 02post oak ph 2post oak ph 3post oak ph 5bpost oak phase 2post oak phase onepost oak ph onepost oak ranchpost oak sub ph 6post roadpoteetpoteet-scales addn lt 1poteet originalpoteet original - atascosa countypothpoth old townpoth trpotranco acrespotranco oakspotranco ranch medina countypotranco runpotranco sub ut-4potranco westpoundhouse hills sec 2poundhouse hills sec onepowellpowell a lgp pauly abstpraderapradera escondida ranchpradera ridgepradoprado ranchprado ranch ph 1prado ranch subd phs 3prado ranch sub ph 3praesel iipraesel iiipraire creekprairie acresprairie greenprairie lakesprairie lakes ph 1 sec 2prairie lakes ph 2 sec 2prairielandprairie leaprairie meadows sec 2aprairie meadows sec 2bprairie on the creek sec 1cprairie on the creek sec 3bprairie park #1prairie rdg ph 2prairie rdg ph iiprairie rdg ph ii abs #14prairie rdg ph iiiprairie ridgeprairie ridge phase 2prairie ridge phase iiiprairie ridge ph iprairie ridge ph iiiprairie view estatesprairie view estates ph thrprairie windsprather placeprecision addpreiss heightspreiss ranchpremontpresa grandepresa pointprescott creek ranch subdivisionprescott oakspreservation ranchpreservation square condopreserve/gann ranchpreserve/mayfield ranch condospreserve/oak hillpreserve at annabelle ranchpreserve at castle hillspreserve at chula vistapreserve at culebrapreserve at dyer creek ph 01preserve at escalera ranchpreserve at four points centrepreserve at gann ranchpreserve at indian springspreserve at lions parkpreserve at mayfieldpreserve at mayfield ranchpreserve at medinapreserve at research enclavepreserve at river place sec 02preserve at stone oakpreserve at stone oak ph 01 sepreserve at stone oak ph 03 sec 01preserve at stone oak ph 03 sec 02preserve at stone oak ph 03 sec 03preserve at stone oak ph 1 spreserve at stone oak ph 1 sec 2preserve at stone oak ph 1 sec 3preserve at stone oak ph 1 sec 4preserve at stone oak ph 2 sec 2preserve at stone oak ph 2 sec 3preserve at stone oak ph 3 sec 1preserve at stone oak ph 3 sec 2preserve at stone oak ph 3 sec 3preserve at stone oak ph 3 sec 4preserve at stone oak ph 4 sec 1preserve at stone oak ph 4 sec 2preserve at thousand oakspreserve at walnut springspreserve of mission valleypreserve ph 01preserve ph 02preserve the 5presidential glenpresidential glen ph 1apresidential glen ph 2presidential glen ph 3presidential glen ph4presidential glen ph 4apresidential glen ph 4bpresidential glen ph 5presidential glen ph6presidential glen ph 7presidential heightspresidential heights ph 1presidential heights ph 2presidential heights ph 5presidential heights ph 6presidential heights phs 2presidential heights phs 3presidential heights phs 5presidential heights ph two 2presidential mdws sec 9presidential mdws sec 11presidential mdws sec 15presidential mdws sec 17presidential mdws sec 18presidential mdws sec elevenpresidential mdws sec fifteenpresidential meadowspresidential meadows sec 01presidential meadows sec 03presidential meadows sec 04presidential meadows sec 5presidential meadows sec 6presidential meadows sec 9presidential ph 5presidents parkpresidiopresidio condopresidio condospresidio of lost creekpresidio stationprestage subpreston estatespreston hollowpreston hollow nepreston park sec 1preston park sec 2bpreston villagepreswyck hills sec 01preswyck hills sec 03preswyck hills sec 04preswyck hills sec 05prewitt leviprimitive pines repprimroseprimrose estatesprimrose no 1 addnprince solmsprince solms heights addprince solms heights add ncb 4013princetonprivada tamaraprivateprivilege estatesprock g cprofit place ph iipromenadeprominencepromiseland estatespromontory point/stone oakpromontory pointeprophet placeproposed courtyard homes ph 4prospect creek at kinder ranchprospect hillprospect hill/rosedale parkprospect park ph 1prosper hope 19-3/4 labor survprovedor ranchprovenceprovence - 60'provence ph 1 sec 5aprovence ridgeprovidence condos 7611providence placeprovince at vineyardprovince condominiumsprovincia villasp smith - cross plainsptof 3public condospublic condos bldg 1public condos bldg 2public condos bldg 3pueblo pasquero subpuerta del lobo texaspuett addpulman acrespunta verdepurdonpurmelapurser crossing ph fourpurser crossing ph onepurser crossing ph twopurser estatespurser robinson commercial tractpurser robinson comm trapursleypuschmanputman drive condominiumsputnam palms condominiumputnam square condoputney-moorep zarzaqindcrestqmd areaq ranchquadrangle condoquadrangle condo amdquail creekquail creek additionquail creek estatesquail creek gdn hms nsquail creek ph 02 sec 01quail creek ph 02 sec 02quail creek ph 02 sec 03quail creek ph 02 sec 05quail creek ph 03 sec 01quail creek ph 04 sec 01quail creek ph 04 sec 02quail creek sec 02quail creek sec 03quail creek sec 03 ph 02quail creek sec 04quail creek sec 05 01 resubquail creek sec 07 ph 01quail creek westquailcreek westquail creek west ph 02 sec 01quail creek west ph 02 sec 05quail creek west ph 02 sec 06quail creek west ph 02 sec 07quail creek west ph 02 sec 08quail creek west ph 02 sec 09quail creek west ph 02 sec 12quail creek west sec 01quail creek west sec 03quail creek west sec 04quail estates ph 1quail hollowquail hollow estates rep lquail hollow garden homes secquail hollow garden homes sec 02 amdquail hollow sec 01quail hollow sec 02quail hollow sec 04quail hollow sec 04-aquail hollow sec 05-aquail hollow sec 06-aquail hollow sec 07quail hollow sec 08 amdquail hollow sec 4quail hollow sec 4-aquail meadowquail meadowsquail ridgequail ridge 20505quail ridge subquail runquail run 1quail run condo amdquail valleyquail valley 1quail valley 2quail valley 3quail valley 4aquail valley sec 01quail vly sec 01quail vly sec 02quarry at iron mountainquarry lake estatesquarry oaks amdquarry oaks condoquarry ph 1quarry spgs sec 1quarry spgs sec 2quarters condominiumsquarters condosquatro addqueen cityquemadoquercus condoquest villagequest village sec 04 amdquest village sec 06quest village sec 08quiet creekquihiquinlan creek estatesquintana/south san area (ss)quintana/south san ssquintana roadquintanilla addrr & kr & k #3r & k #3, block 2, lot 8r & sr & s skinner lp addr.l. mckinney a207r20is - storage warehouse-e round rockr455522c-homestead at old settlers parkrarabb inwood hillsraceway add 2raceway addition-section oneraceway add ph 3raceway single family sub secrachel doddracoon ridgeracquet club of camiragsdalerahman sub ph onerahman sub ph threerahman sub ph tworailheadrailroadrailroad addnrailyard city budarail yard river estatesrailyard river estatesrainbow hillsrainbow hotz ranch estatesrainbow parkerainbow ranchrainey districtrainey district *vesper*rainey streetrainey street historic districtraintreeraintree/antonio hghlndsraintree estatesraintree gardensraintree woodsrallsralph e sevey survralph e sevey surv #526 abs #4ralston creek estatesramble ridgeramblewood 1st unitramblewood 2nd unitramblewood 3rd unitramblewood estatesramburger addramendu at lyndon ln condominiumsramms subrampart crossingramseyramsey park condoranch & cypress crk sec 06ranch/brushy crk north ph 2ranch/brushy crk sec 7dranch/brushy crk sec 8aranch/brushy crk sec 10branch/brushy crk sec 11a & 11branch/bushy crk sec 10aranch acreageranch at brushy creekranch at brushy creek estatesranch at brushy creek north ph 1ranch at brushy creek sec 01ranch at brushy creek sec 01 amdranch at brushy creek sec 03ranch at brushy creek sec 04ranch at brushy creek sec 05ranch at brushy creek sec 06ranch at brushy creek sec 07dranch at brushy creek sec 2a (amd)ranch at brushy creek sec 2a amdranch at brushy creek sec 2b amdranch at brushy creek sec 7cranch at brushy creek sec 8branch at brushy creek sec 9aranch at brushy creek sec 10b subranch at brushy creek southranch at brushy crk sec 3ranch at cypress creekranch at cypress creek sec 01ranch at cypress creek sec 06ranch at cypress creek sec 08 revranch at cypress creek sec 09ranch at cypress creek sec 12ranch at cypress creek sec 16-ranch at cypress creek sec 16cranch at deer creekranch at deer creek ph 03 secranch at deer creek ph 1 secranch at deer creek ph 2 secranch at deer creek ph 3 secranch at delaware creekranch at lakeside sec 01ranch at latitude 31ranch brushy crk sec 02branch countryranch cypress crk sec 12ranchers estatesranches/bentley rdg ph 2ranches/crabapple crk subranches/live oak ph iranches/pioneer passranches/salado brookranches at bentley ridgeranches at big mountainranchesat big mountainranches at blackbuck ridgeranches at buck ridgeranches at canyon creekranches at canyon crossingranches at cr 211ranches at crabapple creekranches at crestwood ridgeranches at double hornranches at dripping springsranchesat dripping springsranches at hamilton pool theranches at hamilton pool the rranches at hamilton ridgeranches at overhillsranches at rifle ridgeranches at rio frioranches at salado brookranches at sentinel peakranches at table rock phs iiranches at table rock phs i unranches at well creekranches of brushy topranchitos amistadranchitos of niederwaldranchland estatesranchland hillsranch land oaksranchland oaksrancho alto ph 01rancho alto ph 02rancho alto ph 03rancho carlotarancho carribe sec 1 & 2rancho chula vistarancho de cost subrancho del cielorancho del cielo ph 1rancho del cielo ph 2arancho del cielo ph 2b sec 1rancho del cielo ph 2b sec 2rancho del cielo ph 3rancho del cielo ph irancho del lagorancho del lago 2rancho del lago 7rancho del lago 9rancho del lago 10rancho del lago 11rancho del lago 12rancho del lago ph 10rancho del lago ph 11rancho del lago ph 12rancho del lago ph ivrancho del lago westrancho de los cielosrancho developmentrancho encino ph irancho granderancho laderarancho linda vistaranch on lake lbjrancho realrancho real iiirancho san gabrielrancho san gabriel ph 1rancho santa ferancho santa fe sec 3rancho siena sec 01rancho siennarancho sienna/ the villasrancho sienna 70rancho sienna ph 1 sec 11rancho sienna ph 2 sec 14rancho sienna sec 01rancho sienna sec 1rancho sienna sec 2rancho sienna sec 3rancho sienna sec 4 ph 1rancho sienna sec 5brancho sienna sec 6rancho sienna sec 7rancho sienna sec 8rancho sienna sec 9rancho sienna sec 11 ph 3rancho sienna sec 12brancho sienna sec 13a & 13brancho sienna sec 15rancho sienna sec 16rancho sienna sec 18arancho sienna sec 18brancho verde sec 10rancho vistaranch sec 02ranch sec 08ranch sec 09ranch sec 11ranch sec 12-aranch unit-4cranch view estatesrancier heights addrancier heights ext 1randall port lavacarandolph crossingrandolph valleyrandolph vly estates un 4range #1 east/water streetrange #3range 1range 2 four league grantranger creekrather 2ndraven estatesravenhillravenscroft twnhms amdraw landray berglund blvd sec 02rayburn arearayburn countryrayburn valleyraymondvillerayner ranchr b irviner b milesr brownrd addr d brd barrick subreaganreagan crossingreagan crossingsreagans crossingreagans overlookreagan wellsrealitosreality point subreal street homesreata eastreata east rep lts 04-9 blk c pudreata trails unit 02reata trails unit 04 resubreatzchreavis ranchrebecca burleson surv abs #52rebecca creekrebecca creek estrebecca creek parkrebecca creek park 1rebecca creek park 2rebecca creek park 3rebecca creek ranchesrebecca creek ranches 1rebecca creek ranches 2rebecca crossingrebecca moore surv abs39rebeccas xingrector crectorsredbirdred bird ranchredbird ranchred bluff creekred bluff lake estatesred bluff ranchred bud add bertramredbud ranchred coveredd & hank condosredfield, henry predfish retreatredfish retreat subredfish retreat sub ph 1redfish retreat sub ph 2ared gully creekred hawk landingred hill ranchred hill ranchesred horsered horse manorred horse manor un 1red horse ridgeredland estatesredland heightsredland oaksredland ranchredland ranch elm crredland ridgeredland ridge neredland springsredland woodsred oakred oak mountainred oaks sec 1cred oaks sec 2red oaks sec 3red riverred river north condo amdred river ranchred robinred rockred rock hillsred rock hills sub phared townred wagon ranchettes sec 02red wing estatesreed secondreese r&r additionrees landing estatesreflections of walnut creek ireflections of walnut creek iireflections of walnut creek iii condoreflections of walnut creek iii condominreflections of walnut ridgereflections walnut creek 01 condoreflections walnut ridge condorefugioregal oaksregatta oaks subregency at esperanza - flamenco collectionregency at esperanza - sardana collectionregency at esperanza - zambra collectionregency at esperanza sardanaregency at santa rita ranchregency at santa rita ranch - garden collectionregency at santa rita ranch - meadow collectionregency at santa rita ranch - orchard collectionregency meadowregency parkregency park neregency placeregency ridge subregency santa ritaregent parkregis square apartmentsreid, samuel hreid ranchremington heightsremington ranchremington ranch addremount arearemuda ranchremuda ranch north subdremuda ranch south ut-3remuda rangerenaissance at the dominionreneau jrenegade ranch northrenorepjam subreplat of hilltop additionreplat of of lot 5 of 3g ranchrepublic creekrepublic oaksreservation ranchreserve/caballo ranchreserve/caballo ranch condosreserve/mockingbird heightsreserve/north fork subreserve/pea rdg ph ireserve/pea rdg ph iireserve at avery ranch 03reserve at berry creekreserve at culebra creekreserve at falling waterreserve at hudson bendreserve at lake travisreserve at mckinney fallsreserve at mesa oaks thereserve at north forkreserve at north fork subreserve at northwoodreserve at old fredericksburg roadreserve at penley parkreserve at potranco oaksreserve at sonoma verdereserve at southpark meadowsreserve at southpark meadows ireserve at southpark meadows preserve at southpark meadows ph 1breserve at thousand oaksreserve at twin creeks sec 13reserve at westcreekreserve at westcreek amdreserve condo amdresidences at dantonis crossresidentialresidential condo amd 360residential condo amd 360 (the 360 tower)retablo ranchretamaretama garden homesretama ridgeretama springsretirement village 01retirement village 02retirement village 03retirement village amd 7a&81aretirement village no 1retreat/hero wayretreat/oakhills bl 13664 ph iretreat at glen heatherretreat at harris ridge condomretreat at hero wayretreat at ingram hillsretreat at oak hillsretreat at retama parkretreat at riverside the condominiumsretreat at san gabrielretreat at steiner ranchretreat at tech ridgeretreat at tech ridge sec 1 thretreat at tech ridge sec 2 thretreat at town centre condoreuben hornsby headright leaguereuben hornsby surv abs # 17reunion ranchreunion ranch ph 2 sec 2reunion ranch ph three sec onereunion ranch ph three sec tworeveile add 02reven acresreverlyreynold's crossingreynolds crossingreynolds erlenereynolds xing ph ir fisherr flippenr flippin iclr grahamrhônerhine terracerhine valleyrhine vly sub un 3brhodes & puett addrhodes sec 01rhone - chamonix condominiumsriadariada 2riatariata at iron horse canyonriata terraceriawrice rdrice roadrichard callender bayfront addrichard hailey surv abs #341richards firstrichardsonsrichardson subrichesonrichey subrichland estates sec 01richland hilrichland springsrichmondrichter additionrichter add ph 2rickelmanridens bldgridge/blackhawk ph 1 sec 1ridge/cross crkridge/knob crk ph 1ridge/slaughter condos bldg 17ridge at alta vistaridge at alta vista resubridge at balconesridge at belle meadowsridge at blackhawkridge at canyon springsridge at carolina crridge at deer creekridge at knob creekridge at slaughterridge at steeds crossing sec 02 ph bridge at steeds crossing sec 1ridge at steeds crossing sec 2ridge at stonecliffridge at thomas spgsridge creekridgecrestridgecrest villas/casinasridge deer creek #2ridgefield ph 01ridge harborridge havenridgelake shores 1ridgelandridgelearidgelea courtridgelea groveridgelea park condo amdridgemontridgemont un 4 subridgeoaksridge of silverado hillsridge point estatesridge point estates ph 1ridge point estates ph 2ridgerow village at wildflowerridgetopridgetop add 04ridgetop annexridgetop anxridgetop condoridgetop gardensridgetop gardens sec 02ridge viewridgeviewridge view estatesridgeview estatesridge view estates #1ridgeview oaksridgeview oaks eastridgeview oaks westridgeview ph 1ridgeview ph iiridgeview ranchridgewayridgewood estatesridgewood estates sec 2ridgewood northridgewood of saladoridgewood south ph 02ridgewood villageridgewood village sec 01ridgewood village sec 02ridgewood village sec 04ridgewood village sec 05ridgewood village sec 06ridgewood village sec 5ridgewood village sec iiridgewood village | rollingwoodridgewood village | rollingwood | west lake hillsridgley parkridgmar landingrienhardt jrigsby add to blmtrileysriley subrimes ranch ph iirimes ranch sub phrim rockrim rock ph 03 sec 03rim rock ph 1 sec 1rim rock phase two sec two, block a, lot 28, acresrim rock ph one sec fiverim rock ph three sec threerim rock ph two sec fourrim rock ph two sec threerim rock ph two sec tworim rock ranchrim rock ranch 2rim rock ranch 3rinconada heightsrio anchorio ancho san gabrielrio ancho sec 2rio escondidorio escondido ph 3rio escondido ph 4rio escondido ph 6rio escondido ph 6 subrio escondido phase 2rio escondido phs 5 unrecordedrio escondido sub ph 4rio esoncdidorio friorio gabrielrio grande & west 29 5 condosrio grande condorio grande condominiumsrio guadaluperio guadalupe condosrio guadalupe condos un 113rio guadalupe ph iirio hondorio hondo / rio honditorio hondo ranchrio llanorio lobo ph 1rio lobo ph 2rio medinario medina estatesriomedinawrio nueces ranchrio parkrio ranchrio rancherorio rancherosrio ranch texas community association, incrio secorios subrio stone ph. 1rio stone ph 1rio vistario vista addrio vista ranchrio vista ranch sec fourrio vista ranch sec threerio vista terracerio vista terrace #2rio vista terrace #3riposa vitarippy-baker subrive bend estatesriverriver's bend at pecan parkriver's edgeriver - guadalupe countyriverariver bendriver bend #1river bend #2river bend 05 ph 03river bend 1riverbend at double eagleriver bend estatesriver bend estates 2river bend oaksriver bend of caminoriver bend on lake lbjriver bend ranchriverbend sec 03a at university hillsriverbend sec 3b resub at univriverbend sec 3c at universityriver bend unit 02river bend unit 05 ph 01river bluffriver bluff estatesriver bluff ranchriver bridge ranchriver chaseriver chase 1river chase 1-3river chase 2river chase 3river chase 4river chase 4-10river chase 6river chase 7river chase 8river chase 10riverchase mobile home parkriver city lofts condo amdriver cliff estatesrivercliff hoarivercliff sec 2 phs ariver country acresrivercrest add sec 01rivercrest add sec 02rivercrest heightsrivercrest heights 1rivercrest heights 4rivercrest heights 6rivercrest placeriver crossingriver crossing (gated)river crossing 2river crossing 3river crossing 7river crossing carriage housesriver crossing condoriver crossing condominiumsriver dance ph 05river dance ph 6-briver dance ph 6ariver dance ph 6a (steiner ranch)river dance ph 6a, steiner ranchriver enclaveriver estates sec 2riverforestriverforest 1riverforest 2river forest addriver haven sub sec iiiriverhillriver hills #2river hills ranchriver hills ranchesriver hills ranches ph 1river hills ranches ph 1 ranchriver hills ranches ph 2-ariver hills ranches ph 2-a 101river hills ranches ph 2-a ranriver hills ranches ph 2ariver hills sec 1river meadowsriver meadows - ph oneriver meadows ph 5river mistrivermistriver mist u-1rivermontrivermont 4river mountain ranchriver mountain ranch sec 2river mountain ranch sec 6 ph tworiver oak lake estates sec 02river oak lake estates sec 04river oak lake estates sec 07river oaksriver oaks 1river oaks estatesriver oaks estates no 2river oaks no 4river oaks of wimberleyriver oaks of wimberley unit 1river oaks of wimberley unit 2river oaks of wimberley unit 4river oaks of wimberley unit 5river oaks ranchriver oaks ranch 1 resubdriver oaks ranch banriver oaks ranch ph 2river oaks townhomes condos ph 2river parkriver placeriver place, milky way at river placeriver place add sec 1river place at grueneriver place estatesriver place estates ph fourriver place estates ph iiiriver place estates ph ix sriver place grueneriver place sec 02river place sec 02ariver place sec 04river place sec 05 amdriver place sec 06river place sec 07ariver place sec 07briver place sec 13river place sec 15river place sec 22river place sec 25river place sec 25 amd of ltsriver pointriver pointeriver point estatesriver point estates 2river pt estriver ranch estatesriver rdg ranch subriver rdg ranch sub tr 2river ridgeriver ridge 03 sec a a vacation & resubriver ridge 03 sec b a vacation & resubriver ridge 03 sec d vacation & resub a priver ridge 1river ridge ranchriver ridge ranch sec iriver ridge ranch sec iiiriver ridge ranch sec ii priver ridge ranch sec vriver ridge sec 02-ariver ridge sec 2-ariver roadriver road estatesriver road terraceriver road villasriver road villas condoriver rock ranchriver rock ranch ut-2briver runriver run ranch estatesriverscaperivers crossingrivers crossing ph 02rivers crossing ph 03rivers crossing subrivers edge 3rivers edge at gruenerivers end estatesriversideriverside #1riverside 448riverside acresriverside groveriverside grove phriverside grove sub phriverside meadows sec 01riverside meadows sec 02riverside parkriverside tower & 495 ph ariverside villasriverside villas amdriverside vistariverstoneriverstone-utriverstone at alamo ranchriverstone at westpointriverstone at westpointeriverstone at westpointegrivers xing ph 03river terraceriver timberriver trailriver treerivertreerivertree 1river valley estatesriver valley estates 1river valley fair oaks ranchriver valley viewriver viewriverviewriverview addriverview condominiumriverview estatesriverview mallriverview residences subriver vistasriverwalkriverwalk condo amdriverwalk ph 01 sec 01riverwalk ph 01 sec 02riverwalk ph 02 sec 01riverwalk ph 02 sec 2ariverwalk ph 1 sec 3riverwalk ph 2 sec 3riverwalk ph 2 sec 4riverwalk ph 2 sec 5riverwalk ph 3 sec 1riverwalk ph 3 sec 3riverwalk ph 3 sec 4riverwalk residences condoriverwood acresriverwood sec 01rivery comm subrivierariviera springsrivoli condorivr bend estatesr k knowlesr m ranch 05rnroanoke condo nsroaring springsrobardsrobards - paper stsrobbins pasturerobbins placerobbins place condo amdrobbins place condominiumsrobert cunningham surv abs #19robertcunningham surv abs #199robert leerobert lile surv abs #391roberts addroberts addition, block 001 lot 0026roberts add sec threeroberts add sec tworobert sellersroberts george f 02robertsonrobertson geo. l.robertson george lroberts terracerobin hood estatesrobin hood estates ph tworobinsonrobinson, j.b. sur.robison canyon estatesrobison ranchrobison ridge estatesrob royrob roy estatesrob roy on creek sec 03rob roy on creek sec 05rob roy on lake sec 01rob roy on lake sec 02rob roy on the creekrob roy ph 02rob roy westrobstownrobstown t/srochellerockcliff estatesrock creekrockdalerocking m ranchrockin j ranchrockinj ranchrock islandrockportrockport cottagesrockport country clubrockport country club #3rockport raquet & yacht clubrockspringsrockwallrockwall ranchrockwall ranch 1rockwall ranch 3rockwall ranch 4rockwall ranch 5rockwall ranch 6rockwell villagerockwell village condorocky creekrocky creek ranchrocky creek ranch 2rocky creek ranch 3rocky creek ranch 5rocky creek ranch 8rocky creek ranch 11rocky creek ranch 14rocky creek ranch 16rocky creek ranch phase 16rocky creek ranch sec 01rocky creek ranch sec 2rocky creek ranch sec 3rocky hollowrocky hollow estaterocky hollow estatesrocky hollow ranchrocky hollow sub ph iirocky mountain ranchrocky pointrocky point ranchrocky ranch acresrocky ranch acres sec 1rocky ranch acres sec 2rocky river ranchrocky subrocky trailrodeo arena devrodriguez proebuck, j. sur, ac 26.07rogersrogers, josephrogers f orogers originalrogers ranchrogers subrolling acresrolling acres sec irolling creekrolling glenrolling heightsrolling hill meadowrolling hillsrolling hills estaterolling hills estatesrolling hills estates, lot 528 & 529rolling hills estates 1rolling hills estates 2rolling hills estates 3rolling hills estates sec 1rolling hills first extrolling hills ranchrolling hills reserverolling hills reserve ph 1rolling hills sec 2rolling hills second extrolling meadowsrolling meadows ph-3rolling oaksrolling oaks #1rolling oaks estatesrolling oaks farmrolling oaks ranchrolling oaks ranch sec 4rolling oaks sec 2rolling oaks sec 3rolling oaks sec 4rolling oaks subrolling oaks subdivisionrolling ridgerolling ridge sec 01-arolling ridge sec 02-brolling ridge village throlling valleyrolling valley 3rolling valley 6rolling vistasrollingwoodrollingwood estaterollingwood sec 02rollingwood westlake henry p hill leagueromaronald reagan crossingronald regan crossingrooseveltroosevelt heightsroosevelt landingroosevelt landing-eventideroosevelt mhprooster springsropers addrosa contirosa conti subrosankyrose addrose add.rose add 2nd unitrose add 3rd unitrosebudrosebud ranchesrosedalerosedale grosedale hrosedale parkrose gardenrose garden add un 6rosegarden estatesroseheartroseheart subrose hillroseland heights #2roseland heights of pieper plaroselawnroselawn add blks 3-6roselle add unit 1rose meadowsrosemontrosemont hillrosenbergrosenberg paula 451rosenbusch ranchrosenbusch ranch ph 1rosenbusch ranch ph onerosenthal estatesrose valleyroseville/manor condos bldg 3roseville on manorrose vly ph 2arosewoodrosewood addrosewood commrosewood commercial additionrosewood estatesrosewood gardensrosewood spgs ph 1rosewood springs ph 1rosewood villagerosewood village sec 08 amdrosewood village sec 8rosewood village sec 11rosharonrosillo creekrosillo creek unit-1rosillo creek unit 1rosillo ranchross road (sundance crossing)ross road subross road subdross road subdivision (sundance crossing)rough holllow-hacienda heightsrough hollowrough hollow (lakeway highlands)rough hollow, lakeway highlands ph 2 sec 4rough hollow, the highlandsrough hollow - east rimrough hollow - hacienda heightsrough hollow- hacienda heightsrough hollow- lake ridgerough hollow-lakeway highlands ph 1 sec 3rough hollow- las brisas estatesrough hollow- the bluffsrough hollow-the overlookrough hollow - the peninsularough hollow - the pointrough hollow canyon passrough hollow condosrough hollow east rimrough hollow hacienda heightsrough hollow lakesiderough hollow overlook ridgerough hollow sec 02rough hollow sec 07rough hollow sec 1 amdlt1-6,11rough hollow sec 3 condorough hollow sec 10rough hollow sec 10 resub of lrough hollow sec 10 rsb lts 26rough hollow the overlookrough hollow the peninsularoughin hillsround mountainround mountain estatesround mountain estates 02round mountain oaksroundmountain oaksroundmountain oaks revision ofround mountain rdround mountain reserveround rockround rock cityround rock personal warehouseround rock ranchround rock ranch b ph 01 sec 0round rock ranch ph 01 sec 01round rock ranch ph 01 sec 02round rock ranch ph 01 sec 02 amdround rock ranch ph 01 sec 03-c-iround rock ranch ph 01 sec 03around rock ranch ph 01 sec 03bround rock ranch pud 13 ph 02round rock westround rock west office condoround rock west sec 01round rock west sec 02round rock west sec 04round rock west sec 05round rock west sec 06-around rock west sec 06bround toproup acresroush addrousseau, mozearowan acresrowe lanerowe lane estates sec 02rowe looprowenarowlettrowley gardensroy & ec logsdon subroyal crestroyal forestroyal forest comalroyal forrestroyal george condoroyal heightsroyal heights addroyal lane village 01royal oakroyal oak estates sec 01royal oak estates sec 03royal oak estates sec 05royal oaksroyal oaks country clubroyal oaks estatesroyal oaks estates 1-4royal oaks estates 5royal oaks estates 6royal oaks estates 7royal oaks estates 11royal oaks of westcreekroyal oaks subroyal orleans north condoroyal orleans north condo amdroyal pointe sec 01royal rdg bl 16806 un 8royal ridgeroyal ridge gdn hms neroyaltonroyal viewrozier j prpco estatesr p lowerrer ruiz sv-32rrwr smithrualrual ac. area 1ruble addruby crossingruby crossing unit - 1ruby ranchruby ranch ph 3ruby ranch ph 4ruby ranch ph 5ruby ranch ph 6ruby ranch ph 7ruby ranch ph 8rungerunge otrunnellsrunning springs mhpruralrural acresrural acres (common) / sa / ec isds rural metrorural country landrural dale-lytton-ne of lockhart arearural martindale - reedville arearural mcmahan arearural nbhd geo regionrural res 3rural se river rd-dickerson rd-borchert lp arearural_g23ruskrussell j trussell park estatesrust acresrust business parkrustic hillsrustic oaksrust ranchesrust ranchettesrutersvillerutherford west sec 2rutherford west sec 5rutland village sec 01rutledger watsonr w waderyan addryans coveryans crossingryans crossing sec 01ryans crossing sec 04 amdryans crossing sec 05ryans crossing sec 06ryans xingryatt ranchrylanderryswyk estatess & j arocha grant abs #1s & j arocha surs & m 02s. c. s.s. durango/probandts. laredo s.e. to frio city rdsas.o.p.a. subdivisions01150s01620s02330s02330-jourdantons02810s02950s03980s0470 big county annexs0497- bishop crossing subdivision sec 1s0500s0577 - larrys harbor addition (poc)s0622s08380s0850s506s549s1038s1082s1132s1160s1231 - carpenter hill sec 1as1310s1360 - old town lexingtons1557 - edna hills1959s2502 somerville places2507s2653 the reserves2710s3347 - garza ranchs3740 western tr ix lot 15s3950s4620 - glenn h kothmann props4960s5220s5220 horseshoe bay horseshoe bays5310s5320s5720s6059 - old mill subdivisions6130s6160s6500s6560s6600s6740s7222s7259s7260s7540s7600 - rolling oakss7720s7759 - shenandoah subdivision phase ivs7800 - smith, j. s.s7980s8310s8541 - sweet blessings ranchs8578 - tabor adds8903 - trace sub pa 2b sec cs9123 - valley oaks9373 - werth subdivisions9405 - west end condoss10814 - turtle creek village ph 7, block ww, lots11264s16000s44014s80002s a & m g rrsa / ec isds rural metrosabinalsabinal acressabinal condosabinal condominiumssabinas creeksabinas creek ranchsabinas creek ranch phase 1sabinas creek ranch phase 2sabinas crk ranch sub ph 2sabine on 05 residential condosablechases addsaddleback/santa rita ranch phsaddleback at santa rita ranchsaddle bronc acressaddlebrooksaddlebrook ranchsaddlebrook ranch unit 1bsaddle creeksaddlecreeksaddle creek add ph onsaddlecreek condosaddlecreek condossaddlecreek condos ph 10saddle creek estates (ns)saddlecreek ph 1csaddlecreek ph 1dsaddlecreek ph 2csaddlecreek ph 2dsaddlecreek ph 2esaddlecreek ph 4saddlecreek ph 5saddlecreek ph 7 finalsaddlecreek ph 8saddlecreek ph 9saddle creek ranchsaddle creek ranch #1saddle creek ranch #3saddlehornsaddle mountainsaddle rdg/wildhorse ranch secsaddleridgesaddleridge 1saddle ridge at wildhorse ranchsaddle ridge estatessaddleridge estates ph onesaddleridge sec 1saddleridge sec 2saddletree ranchsaddletree ranch sec 03saddletree ranch sec 1saddletree ranch sec 2saddletree ranch sec 3saddlewoodsaddlewood estatessaddlewood estates sec 03sadei addsaegert ranchsaegert ranch commsaegert ranch ph onesaengerhallesaengerhalle estatessaengerhalle mdws un 1saengerhalle mdws un 3saengerhalle meadowssaengerhalle sub un 4sagebrookesagebrooke (common)sage charlessage condosage condossage crk subsage hollowsage mdws west un 1 cb 5193sage meadow condo amdsage meadowssage meadows ph isage meadows ph iisage meadows ph iiisage meadows ut-1sage oakssage valleysage valley sssagewoodsailhousesaint hedwigsaint josephs addsaint vincent estatesai seetha subsaladosalado airport condominiumssalado bluffsalado bluffs nesalado centersalado condosalado creeksalado creek place subsalado mills subsalado mills sub phsalado oakssalado sanctuary ph 1asalado sanctuary ph 1a addsalado sanctuary ph 1bsalado spgs estates secsalado vistasalem center resub of lt b-1salemo ph 7salem pointsalem villagesalem walk sec 02salem xing-ph 1salernosalerno ph 1salerno ph 1 (amd)salerno ph 2salerno ph 5salerno ph 8salerno ph 11salerno ph 14salerno ph 15salinas property subdivisionsalt creek phsaltersaltwater havensaltwater haven #2saltwater haven #2 subsamarasam basssam bass trails sec 01sam houston heightssam houston indust park resam lockhartsamon addsampsonsams placesamuel/smithsamuel c jonessamuel frenchsamuel g hanks league abs 220samuel h. brittonsamuel highsmithsamuel highsmith surv sec 13 asamuel littlesamuel millettsamuel millett surv a-70samuel m williams league #2 absamuel nimmo leaguesamuel p brown league abs #22samuel pharass surv abs 496samuel pharras surv abs #496samuel r coplinger 1/3 leaguesamuels courtsamuels court 725samuel shipesamuel shipe abs 272samule lockhatsamules courtsanaloma estates unit 2san angelosan antoniosan antonio academy sub ncb 17san antonio country estatessan antonio isdsan antonio ranchsan antonio road add sec 03san antonio trustsan antonio trust, block 9, lot 10 part ofsan augustinsan benitosan cascianosan casciano, north lakewaysan casciano; creeksidesanchez 1701 condosanchez acressanctuarysanctuary andsanctuary at costa grandesandcastle condosand dollar ii studio condosanders henry gsandersonsandhill landing sub seadsandhill shores add 2000sandiasandia ridge at the legendssandidge addsan diegosandpiper covesandstone at stonegate iiisandstone ridgesandy creek ranchessandy creek ranches ph 04sandy creek ranches ph 05sandy creek ranches ph 06sandy creek ranches ph 2 secsandy forksandy fork ranchessandy fork subsandy harborsandy hills sosandy mountainsandy mountain estatessandy oak hillssandy oakssandy shoressan felipe de austin town trsan fernandosan francisco sub #2san gabriel estatessan gabriel heightssan gabriel heights sec 02san gabriel heights sec 03san gabriel heights sec 05san gabriel heights sec 06 resubsan gabriel oakssan gabriel place condo amdsan gabriel ranch sec 1san gabriel river estatessan gabriel river ranchsan geronimosan isidrosan josesan jose catholic church subdivisionsan juansan julian creek esan leanna estatessan marcossan marcos river ranchsan marcos river ranch, smrrsan miguel at canyon springssan pedro flatssan pedro flats condosan pedro hillssan pedro hills bl 16384 un 24san pedro ncb 9216san pedro north mobisan pedro oaks condosan pedro placesan pedro squaresan sabasan salvador estatessanta clarasanta clara bendsanta clara bend, ph #4santa fesanta fe estatessanta fe estates subdivisionsanta fe sec 13santa maria at alamo ranchsanta monica parksanta monica park sec 02santa monica park sec 03santa ritasanta rita homesteadsanta rita ranchsanta rita ranch - eldoradosanta rita ranch- eldoradosanta rita ranch - eldorado - maravilla collectionsanta rita ranch - eldorado - sierra collectionsanta rita ranch - eldorado - tesoro collectionsanta rita ranch 60ssanta rita ranch at homesteadsanta rita ranch at saddlebacksanta rita ranch northsanta rita ranch ph 1santa rita ranch ph 1 sec 2asanta rita ranch ph 1 sec 2bsanta rita ranch ph 1 sec 3bsanta rita ranch ph 1 sec 4santa rita ranch ph 1 sec 6asanta rita ranch ph 1 sec 8santa rita ranch ph 1 sec 9santa rita ranch ph 1 sec 10santa rita ranch ph 1 sec 14santa rita ranch ph 1 sec 18santa rita ranch ph 1 sec 18 rsanta rita ranch ph 1 sec 20asanta rita ranch ph 1 sec 21santa rita ranch ph 1 sev 21santa rita ranch ph 2a sec 3santa rita ranch ph 3 sec 1santa rita ranch ph 3 sec 2santa rita ranch ph 4 sec 1 resanta rita ranch ph 4 sec 2santa rita ranch ph 5 sec 1santa rita ranch ph 5 sec 3asanta rita ranch ph 5 sec 3dsanta rita ranch ph 7a sec 1santa rita ranch ph 7b sec 3 - 60santa rita ranch ph 7b sec 4 - 50santa rita ranch ph 7b sec 4-50santa rita ranch southsanta rita ranch south sec 4asanta rita ranch south sec 4bsanta rita ranch south sec 5asanta rita ranch south sec 7bsanta rita ranch south sec 9asanta rita ranch south sec 11santa rita ranch south sec 12santa rita ranch south sec 14santa rita ranch south sec 16santa rita ranch south sec 17santa rita south sec 3asanta rita south sec 4asanta rosa condossanta rosa terrace sec onesantiago del valle 10 league gsantiago del valle grantsantiago del valle grant a-24santiago del valle grant abs #santiago del valle grant abs 2santiago del valle surv abs #2santiago del valle ten leaguesantiago gonzales tract pt 2 &sapiah plains additionsapphire grovesapphire meadowssa pughsarah and lydia m. robertson's subdivisionsarah gainer surv abs #320sarah penningtonsarahs creek sec 02sarahs creek sec 06sarahs creek southsarah smithsarah woodruff surv abs #662saratogasaratoga - guadalupe countysaratoga farmssaratoga farms subsaratoga farms subdivision section sixsaratoga farms sub secsaratoga hillssaratoga spgs sec 02sargdsargeantsargentsargent beach addsarina adeni's chalet iisarita valleysarita valley condosarita valley ph 4sarita vly condossartia vly ph ivsassine squaresattler estatessattler villagesattler village 7satuche anastaciosaucedo street condominiumssaucedo subsauder farmssauder farms #2sauls ranchsauls ranch eastsaunderss austin industrial parksavannah bluffsavannah circlesavannah condosavannah heightssavannah heights ph iisavannah oaks subsavannah placesavannah place unit 1savannah place unit 3savannah squaresavanna ranchsavanna ranch sec 2savanna ranch sec 3savanna ranch sec 4savanna ridge ranchsavings center commsawlog bendsawyer ranch 33sawyer ranch 33 tract threesawyer ranch 33 tr onesawyer ranch crossing condo lt 2asawyer ranch sec 5saxonysb0012sb0029scscarlet oaksscarlett oaksscattered oaksscattered oaks subs c colville surveyscenic brook estates sec 01scenic brook estates sec 1 phscenic brook estates sec 2 re-scenic brook estates sec 2 re-amendscenic brook west sec 01scenic brook west sec 02 ph 02scenic brook west sec 03 ph 02scenic canyonscenic crestscenic harborscenic harbourscenic harbour estatscenic heightsscenic heights 1scenic heights 2scenic heights 3scenic hightsscenic hillsscenic hills #1scenic hills community ph #1scenic hills community ph 1scenic hills estatesscenic oaksscenic place condo amdscenic place condo amd.scenic point ph 02scenic river sub sec 2scenic terracescenic terrace 1scenic valleyscenic valley add 1scenic view westscenic view west sec 02scenic view west sec 04scenic vista estatesscharbauer addscheel farmsschertzschertz ih 35 warehouseschicke pointschieffer place sec 03schillerschillers owl creek park estateschl addschmid-grahmannschmidtschneider hillschoenest-welt add 510schoenthal ranchschomer acresschoolschriber ranchschroeder areaschubert estatesschuelingschuessler lakeschulenburgschuler addschumann & staats addschutze resub of tr b of isschwertner ranchschwertner ranch ph 3schwingescience parkscofield farmscofield farmsscofield farms estatesscofield farms mdws condoscofield farms mdws condosscofield farms meadowsscofield farms ph 01 sec 01scofield farms ph 01 sec 02-ascofield farms ph 02 sec 01scofield farms ph 03 sec 03scofield farms ph 08 sec 03scofield farms ph 08 sec 07scofield farms ph 3 sec 2scofield farms ph 10 sec 01scofield farms ph 10 sec 02scofield farms ph 10 sec 03scofield farms phs 1 sec 1scofield ph 06 sec 03scofield ph 06 sec 04scofield ridge condo amdscofield ridge condominiums amendedscofield villasscofield villas amdscofield villas condominiumss congress loftsscott acresscott creek 01-ascott g wscott hollowscott ranch medio pasturescottsdale crossingscottswoodscucisd/judson ruralscucisd/judson rural development eastscucisd judson rural development eastsdeins durango/probandtseseadriftseadrift townsiteseagrass at rockportsea gull condoseaholmseaholm residences residentialseale solomonseale subdsealyseaport lakes sub seadsearight villagesearight village condosearight vlg condossea willow estatesseawillow estatesseawind 03seayseay worldsec hutto parke 03sec hutto parke 06secluded oak villas condoseco passseco ridgesedonasedro eastsee brokersee commentsseekatz red covesee legalsee legal descriptionseemarkssee remarksseguinseguin neighborhood 01seguin neighborhood 03seguin ruralseiders h bseiders oak condoselkirk island sec 2sellers estatesselmaselman subselma park est-stdselma park estatesselma park estates sub un i countysenate hills sec 01senderasendera crossingsendera estatesendera estates subsendera ridgesendera sec 12-asendera sec 15sendera sec 15 bsendera sec 16sendera south sec 01sendera south sec 02sendera south sec 4sendera subsendero at veramendisendero crossingsendero estatessendero hillssendero hills ph 03 amd ofsendero ranchsendero ridgesendero ridge ranchsendero spgs sec 04sendero spgs sec 05 finalsendero spgs sec 6sendero springsseneca estatesseneca estates nsseneca trailssenecs trailssennasenna hillssenna hills sec 01-bsenna hills sec 10senna hills sec 11sentinel peakserenada country estatesserena woodsserendipity subserene and scenic hillsserene hillsserene hills; lakewayserene hills estatesserene hills ph 3wa & repserene hills ph 3wbserene hills sub ph 2eserene hills sub ph 2e; lakewayserene hills sub ph 2wserene hills sub ph 3eserenity estatesserenity estate subserenity oaksserenity oaks 2serenity oaks un 4serenity ranch estatesserenity spgs ph 1serenity spgs ph iserenity springsserenity springs ph1serenity subdivisionsereno springssernas estatessetterfeld estatessetterfeld estates 1settlement/fatriot ranch un 1settlement/gruenesettlement/gruene un 3settlement/gruene un 4settlement/patriot ranch un 1settlement/patriot ranch un 2settlement/patriot un 1settlement/stagecoachsettlement at gruenesettlement at gruene 1settlement at gruene 2settlement at patriot ranchessettlement on the coloradosettlement sec 01settlement sec 02settlement sec 03settler's meadow sec 03settler condominiumssettlers creeksettlers crossing sec 01settlers crossing sec 02settlers crossing sec 03settlers meadow sec 01settlers meadow sec 03settlers meadow sec 04settlers overlooksettlers overlook northsettlers overlook sec 01settlers overlook sec 02settlers overlook sec 03settlers passsettlers point ph 1settlers rdg subsettlers ridgesettlers ridge sec 01settlers ridge sec 03settlers ridge sec 04 ph 01settlers ridge sec 04 ph 02seven covesseven coves tr 2seven falls ranchseven hills ranchseven oaksseven oaks sec 05seven springsseven springs ranchseventy raineys evettssevier tadlock surv abs #872sevilles f mcallister addshsh 46 indust parkshadow acresshadow canyonshadow canyon ph 3shadow canyon ph 4shadow canyon ph 7shadow creekshadow creek ph 1 sec 2shadow creek ph 1 sec 3shadow creek ph 1 sec 4shadow creek ph 1 sec 6shadow creek ph 1 sec 7shadow creek ph 2 sec 1shadow creek ph 2 sec 2shadow creek ph 2 sec 3shadow creek ph 3 sec 3shadow creek ph 3 sec 4shadow creek ph 4 sec 1shadow creek ph 6 sec 2shadow creek ph 7 sec 2shadow creek phase five sec oneshadow creek ph eight sec oneshadow creek ph eight sec twoshadow creek ph five sec oneshadow creek ph nine sec twoshadow creek ph sec 01 01shadow creek ph seven sec threeshadow glenshadowglenshadowglen ph 01 sec 01 a 02 a 03 a 04 ashadowglen ph 01 sec 01 bshadowglen ph 01 sec 02 bshadowglen ph 01 sec 03 bshadowglen ph 01 sec 05shadowglen ph 01 sec 06shadowglen ph 01 sec 07shadowglen ph 01 sec 08shadowglen ph 01 sec 10shadowglen ph 01 sec 12-13shadowglen ph 02 sec 14ashadowglen ph 02 sec 15bshadowglen ph 1 sec 1a,2ashadowglen ph 1 sec 1cshadowglen ph 1 sec 9shadowglen ph 2 sec 14b-phs 2shadowglen ph 2 sec 19ashadowglen ph 2 secs 25-26shadowglen ph 2 secs 27a-27bshadowglen phs 2shadow hill condoshadow hillsshadow lawnshadow mistshadow oaksshadow oaks twnhmsshadowolen ph 2 secs 25-26shadow parkshadow pointeshadow pointe ph 01shadow pointe ph 02shadowridge crossingshadowridge crossing sec 02shadowridge crossing sec 3shadowtree condoshadow valleyshady acresshadybrookshady creek ranchesshady hillshady hollow addshady hollow add sec 02 ph 01shady hollow estates sec 01shady hollow sec 02-a ph 02shady hollow sec 03-a ph 03shady hollow sec 03-bshady hollow sec 06 ph ashady hollow sec 06 ph bshady hollow sec 06 ph cshady hollow sec 06 ph dshady hollow westshady mountainshady oakshady oaksshady oaks estatesshady oaks estates sec 04 ph 04shady oaks terrace #2shady tree estatesshady valley iishady valley iiishaenfield placeshalimar villageshallowatershallow creekshambo ranch estatesshaminaw sec 01shamrockshamrock avenue condominiumsshamrock shoresshamrock shores sec ashangrilashanklin-love addshannon ridgeshannons james r resubshannon valley subsha north abstractsshavano creekshavano forestshavano heightsshavano highlandsshavano oaksshavano office park condoshavano parkshavano park villasshavano ridgeshavano villageshawhan place repshaw jshearer hillssheffieldsheffields sub theshelbyshelby riversheldonsheldon 230sheldon 230 sec 01 ph 01sheldon 230 sec 01 ph 03sheldon 230 sec 02 ph 02sheldon 230 sec 02 ph 03sheldon 230 sec 02 ph 04sheldon 230 sec 02 ph 05sheldon 230 sec 02 ph 8asheldon 230 sec 02 ph 8bsheldon 230 sec 2 ph 7shell addshelley atchison subshelley n gshelley n g subdshell t e surshelton jamesshelton ranch subsheltonsshenandoahshenandoah ishenandoah iishenandoah iiishenandoah ph 01shenandoah ph 03shenandoah sec 02shenandoah sec 05shenandoah sec 06shenandoah sec 2shenandoah subdivision phase oneshenandoah sub ph ishenandoah sub ph oshenandoah sub ph vshepherd mountain ph 02shepherds ranchsheppard s r jr sec 01sheridansherrill addsherry dalesherry dale resubsherwood / hills / oak cliffsherwood acresherwood downssherwood forestsherwood forest cmsherwood heightssherwood manorsherwood oaks sec 02sherwood oaks sec 03sherwood oaks sec 04sherwood oaks sec 06sherwood shoressherwood shores greenbriar sectionsherwood shores iiisherwood shores ivsherwood shores sec isherwood shores vii brigadoonsherwood shores viii cook hillsherwood shores viii hoodsherwood shores viii teer terracesherwood shores vii pecan grovshibui sands - pashiloh ph 01 sec 01shiloh ph 02 sec 01 amdshiloh ph 03shiloh ph 04 sec 01shiloh ph 04 sec 02shiloh subdivisionshiloh terrace ph fourshilo oaksshinershiner landing subshiner townsiteshin oak bendshinoak valleyshinoak valley sec 03shirley williamsshoal creek blvdshoal creek park 02shoal creek unit 4 professionashoal creek unit 4 professional officeshoal crest addshoalmontshoalmont additionshoalmont add resubshoalmont add sec 02shoalmont add sec 03shoalmont allandaleshoalmont sec 05shoal terraceshoal villageshoal village sec 02shoalwoods add sec 02shofner port lavacashoinshookshooting star ranchshops/legends village comm cshops/legends village comm sshops at vista ridge amdshore a condo amd theshore acresshore condominiumsshoreline parkshort adds h osborne surv abs #646shubert estatesshuddemagensshut in creekshypenn 1 subsidney shoressiegmund add sec 03siegmund add sec 04sienasiena patio homessiena ph 1 sec 1siena ph 1 sec 24siena ph 2siena ph 3siena sec 3siena sec 5siena sec 7siena sec 8siena sec 9siena sec 11siena sec 14siena sec 16siena sec 17siena sec 21siena sec 23asiena sec 23bsiena sec 27siena sec 28siena sec 31siena south sec 2siennasienna lakessienna parksierra arbor estatessierra blancasierra la ranasierra northsierra north/the hillssierra oaks 02sierra oaks 04sierra springssierra vistasierra vista, sec 1sierra vista 01sierra vista 03 ph 02sierra vista sec 01sierra vista sec 02sierra vista sec 1sierra west sec 1asierra west sec 3sierra west sec iisiesta acressiesta shores sec 01siesta shores sec 01 revsiesta shores sec 02siesta shores sec 1siesta villagesignal hill estatessignal hill isignal hill subsignature homes subdivision replat (lts 8-13 blk 1)silent valleysilesiasilossilos subsilos un 3silos unit #1silos unit 1 the aka preston est 2silvasilverado at plum creeksilverado at plum creek sec 02asilverado at plum creek sec 1asilverado at plum creek sec 1bsilverado at plum creek sec 2bsilverado at plum creek sec 3asilverado at plum creek sec 4silverado condo amdsilverado condo amd ph 02silverado estates ph onesilverado hillssilverado westsilverado west ph a sec 02silverado west ph b sec 01silverado west ph b sec 02silverado west ph b sec 03silverado west ph b sec 04silverado west ph b sec 06silverbrooksilver canyonsilver creeksilvercreeksilver creek bus parksilver creek estates ph onesilver creek villagesilver creek village i & iisilver creek villassilveredge crk subsilver hillssilver leafsilverleafsilver leaf ph 01silver oaksilver oakssilver oak sec 3silver oak sec 4silver oak sec 5silver oaks iisilver oak townhomessilver oak twnhmssilver oak twnhms bldg 14silver spgs ranchessilver springs ranchessilver spur ranchettes sec 02silver spur ranchettes sec 1silver spur ranchettes sec 2silver stonesilverstone ph 01 sec 01silverstone ph 01 sec 02silverstone ph 02 sec 01silverstone ph 02 sec 02silver stone ph iisilver stone ph iiisilverton heightssilverton heights sec 02silverton valleysilver wingssimank sub 371simmons 1stsimmons valleysimms creek live water ranchsimms paul osimon-caskey finalsimpson & parrsinging hillssingleton bendsintonsinton-welder subsioux city retrt iisir gerald 1sir gerald 2sisterdalesite plan approved for constructionsites ranchsix flagssix pines iiisix twelve park place condominiumss kelloggskidmoreskipchaskipcha hillskipcha mountain estatesskipcha mountain estates phskipcha mountain estates phase seventeenskipcha mt. estskyskybridge loftsskybridge lofts amdskybrookesky forestsky harborsky harbor gardensskylandskyland terraceskylight hillsskylineskyline 2d ph 1skyline 2d ph 2skyline 2d ph 3skyline acresskyline estatesskyline flatsskyline flats phase 1skyline flats phase 2 sectionskyline flats phs 2 sec 2skyline iiskyline oaksskyline oaks sec 1 replatskyline on berkmanskyline parkskyline ranchskyline ranch estatesskyline rdg ph 1skyline ridge #1skyline ridge ph1skyline terrace 1st addskyline terrace 1st extskyline terrace 2nd extskyline terrace 4th extskyline valleyskyline val s ph iskymor carmel creeksky ranchsky ridgeskyridgeskyridge residential condosky valleyskyviewskyview acresskyview belton addskyview manorsky view ranchskyview sec 01skyview sec 02skyview sec 03sky vue acresskyway subs laredo se to frio city rd saslaughter creek acressleepy cove/parman plslm ranch subslotnicksma-mcnair subsmall apt 4 to 10smart elmendorfs mckimbss middletonsmileysmiley ranchsmithsmith, charles ssmith, j ssmith 1st and smith 2ndsmith 2ndsmith acressmith a f addsmith branch parksmith business parksmith dove hollowsmith duwe subsmith e d subdsmithfieldsmithfield condos bldg 15smithfield condos bldg 26smithfield ii condominiumssmith ranchsmith r gsmith s. sursmiths add to liberty hill texassmiths j w western oaks 02-asmiths j w western oaks 02-bsmiths j w western oaks 1asmith sub #1smithvillesmithville citysmithville townsitesmithville townsite, blk 43, lot 17,18,19, 20 fr'ssmithville westsmith w csmithwick mills estatesmithwood subsmokey mountain oakssmooth oak townhomessmyth addsnooksnowden oscar sub repsnow woods ph 2 & 3snyder addsnyder river ranchsoco condominiums plussoda springs farmss of commerce to mlk sas of mlk to aransassolsola city homessolana ridgesolara at highland horizion townhomessola vistasola vista sec 2solm's preservesolmssolms landingsolms lndg condossolms lndg unit-1asolomonsol park estatessolstice at harmony 01soma village condossomersetsomerset 02somerset condosomerset condominiumssomerset grovesomerset meadowssomerset ridgesomerset trailssomervillesomerville placesonder addsonesh estatessonesta west sec 01asonesta westsec 1asongbirdsonneman estate partition 3-313 #sonomasonoma/sonoma southsonoma heightssonoma heights condosonoma mesasonoma oakssonoma ranchsonoma sec 02sonoma sec 03sonoma sec 04sonoma sec 04 finalsonoma sec 06sonoma sec 08sonoma sec 09sonoma sec 11sonoma southsonoma verdesonoma verde/enclavesonoma verde/the estatessonoma verde/the gardenssonoma verde the estatessonoma verde ut-4sonorasonrasonterasonterrasonterra - cool watersonterra/greensviewsonterra/the highlandssonterra 2sonterra 2 condosonterra cool watersonterra i condossonterra ii condossonterra ii condos ph iisonterra ii condos ph ivsonterra ii condos ph visonterra ii condos ph viiisonterra il condos ph iiisonterra one condosonterra ph 2a west sec 7sonterra the 7th atsonterra the midlandssonterra westsonterra west ph 06sonterra west ph 2 sec 12sonterra west ph 2 sec iiisonterra west ph 2a-1 sec 7sonterra west ph 2b-1sonterra west ph 2b-1 rep 01sonterra west ph 4 sec 7sonterra west ph 5asonterra west ph iiasonterra west ph iib-1 rep 01sonterra west ph v-asonterra west sec 03 ph 01sonterra west sec 03 ph isonterra west sec 07-a ph 01 asonterra west sec 07a ph 01 amdsonterra west sec 08-csonterra west sec 08csonterra west sec 7sonterra west sec 7 ph 4sonterra west sec 7a ph 01 amdsonterra west sec 8-bsonterra west sec 8-esonterra west sec 8-fsonterra west sec 8-j ph 3sonterra west sec 8a ph 01sonterra west sec 8csonterrra westsophienburg hill historicsorentosorento condominiumssorento condossorento ph 3sorento ph 7sorento ph 8sorento phs 5sorrentosouthsouth-west now braunfelssouth 05 amdsouthampton sec 01southampton sec 3-asouth austinsouth austin indus park ph asouth austin indust parksouth austin indust park ph asouth austin industrial park - sec asouth banksouthbanksouth bank #1south bank #3southbreezesouth breeze estatessouthbreeze subdsouth brooksouth brook addition 1st ext amendedsouth cherry hollow estatessouth congresssouth congress condiminumssouth creeksouth creek sec 01south creek sec 02south creek sec 04south creek sec 05 revsouth creek sec 06south creek sec 10south creek sec 11south creek sec 12south creek sec 16 amdsouth creek sec 17south creek section 12south creek south sec 02 amdsouthcross ranchsouthcross sub'dsouth downtownsoutheast annexsouth east central ecsouth endsouth end lofts condosouthern crosssouthern cross commsouthern drawsouthern hillssouthern oakssouthern oaks sec 01southern oaks sec 04southern oaks sec 06southern oaks sec 07southern oaks sec 07-bsouthern terracesouthern terrace revsouthern trace ph 02south forksouthfork meadowssouth gatesouthgatesouthgate ph 3southgate ph 4southgate terracesouthglensouthglen subdivision phase 7 blk 6 lot 24, 0.144southgrovesouth heightssouth heights subsouth highlands amdsouth jonestown hillssouth jonestown hills unit 01south jonestown hills unit 1 rsouthlakesouthlake at brooks condominiumssouthlake harborsouthlake ranch ph onesouthlake ranch ph threesouthlake ranch ph twosouth lamarsouthland oaks sec 01southland oaks sec 03-bsouthland oaks sec 04 ph bsouthland oaks sec 04 ph esouthland oaks sec 05south lockhartsouth lund southsouth meadowssouth meadows estatesouth meadows sec isouth meadows sec iisouth meadows sec iiisouth meadows sec ivsouth meadows sec vsouth meadows sec visouth ninetyfivesouth oaksouth oak condosouthoak condosouthoak condominiumssouth oakssouth oaks subsouth overlooksouth padre islandsouth padre island areasouth parksouth park addsouth park add revsouth park add rev resouthpark mdws ph 2asouth park placesouth park sec 01south park sec 02south park sec 2south pointesouth pointe ph isouth pointe ph iisouth pointe ph iiisouthpoint twnhmssouth point un 1south ridgesouthridgesouthridge estatessouthridge estates ph #3southridge parksouthridge plazasouthridge sec 01southridge sec 02southridge sec 03southridge sec 04southridge sec 05southridge sec 06southridge sec 2southridge sec 4south river cityhomes condominiumssouth river unit 1south san antoniosouth san gabriel ranchessouth san gabriel urban renewal blk esouth san gabriel urban renewal blk gsouth san gabriel urban renewal blk nsouth san gabriel urban renewal blk osouth san gabriel urban renewal blk tsouth san villagesouth shore estatessouth shore harbour sec sf 65-south shore pointesouthshore subsouthshore sub first esouthside addsouthside additionsouth side citysouthside ruralsouthside rural acreagesouthside rural developmentsouthside rural development (so)southside rural development(so)southside rural development sosouthside rural sosouthside study area 2 annexationsouth silver creeksouth street villassouth terrace addsouthtonsouthton covesouthton lakesouthton meadowssouthton meadows/southton lakesouthton ranchsouthton villagesouthton woodssouth to pecan valleysouth troy sub amdsouthview addnsouth view estatessouthview hills estates subsouth wall estatessouthwest addsouthwest crossingsouthwest metro acragesouthwest metro acreagesouthwest new braunfel bl 3006southwest oaks duplex condominsouthwest oaks ph 02southwest oaks sec 02southwest parksouthwest park sec 02 amdsouthwest pkwy condosouthwest territory sec 01southwick ranch tr 5southwindsouthwoodsouthwood annexsouthwood hills estatessouthwood oaks subsouthwood sec 01southwood sec 02south woodstonesowell, johnspaces 2525 condospanish acresspanish grantspanish grant subspanish oak acresspanish oak acres phase 2spanish oaksspanish oaks condo amdspanish oaks estatespanish oaks estatesspanish oaks ph 02-bspanish oaks sec 08spanish oaks sec iiicspanish oaks second amdspanish southwestspanish southwest rep blkspanish trailsspanish trails villassparkling springssparkssparks & moore subdspear, c.c. sur.spear g wspears ranchspears ranch on salado creek sec 01speckels & staehely addnspectrum commercial subdivisionspeed additionspeedway annexspeedway condo amd 3000speedway condo amd thespeedway heightsspeedway parkspeer & best subdspencer morrisspencer morris leaguespencer morris surveyspencer ranchspencer r w addspeyside sec 01speyside sec 02s pharr sursphere threespicewoodspicewood at balcones villagesspicewood at balcones village sec 9spicewood at bullcreek sec 03 ph bspicewood at bullcreek sec 3 pspicewood beachspicewood estates sec 01spicewood estates sec 02spicewood forestspicewood forest office condomspicewood point twnhms amdspicewood trailsspicewood village condo amdspicewood vista condo amdspillar & greenwood addnspillman ranch at falconheadspillman ranch ph 01 sec 01spillman ranch ph 01 sec 02spillman ranch ph 01 sec 03spillman ranch ph 01 sec 06spillman ranch ph 02 sec 01spillman ranch ph 03spillman ranch ph 1 sec 9spillman ranch ph 1 sec 10splawn ranch ph fsplawn ranch sub phspoffordspofford addspoke hill sec 02spoke hill sec 2spoke pile subdivisionsponsellerssportsplex sub 3s presa w to riverspringspring branchspring branch iispring branch ii sec fourspring branch ii sec ispring branch sec 01 aspring branch sec 1-bspring branch sec 1-cspring branch sec 1-dspringbrookspringbrook 01 sec 01springbrook 01 sec 02springbrook 01 sec 03springbrook 01 sec 04springbrook centre ph aspringbrook centre ph b sec 01springbrook centre ph b sec 02springbrook enclavespringbrook glen sec 02springbrook glen sec 03springbrook ph 01-aspringbrook ph a sec 01-fspring condo amdspring condo andspring condominiumsspring creekspring creek estatesspring creek forestspring creek hillsspring creek preservespring creek ranch subdspring crkspringdale addspringdale creek condominiumsspringdale crk condospringdale crk condosspringdale hillsspringdale hills sec 02springdale hills sec 04springfield manorspringfield ph b sec 02springfield ph b sec 03springfield ph b sec 05springfield ph cspringfield phs c subdspringfield sec 2springfield sec 4springfield sec 5springfield sec 7springfield sec 8bspring grovespring hillspring hill villagespring hollowspringlakespring lake hillsspring meadowspring mountainspring mountain 1spring oak estatesspring oaks est 2spring oaks estatesspring ridgespring ridge sec 01spring river estatessprings @ rebecca crksprings at boerne stagesprings at rebecca csprings at sonoma ranchsprings at stone oaksprings condo amd thesprings of silverado hillssprings of walnut creek ph isprings of walnut creek ph iisprings ph 1springs rebecca creek 1springs rebecca creek 2spring streetspringswood sec 01springtownspring trails ph 01spring trails ph 3spring trails ph 4spring trails ph 6spring trails ph 7spring trails ph 8spring trails ph 10springtreespringtree unit#3spring valleyspring valley estates ph twspringviewspring vistasspring vistas nsspring vly sub un 2spring vly sub un 3spring willow creekspringwoodspringwood creek estatesspringwood garden homfs un 1 ncbspringwoodsspringwoods 2gspringwoods ii-gspringwoods place condosspringwoods sec 01springwoods sec 01-aspringwoods sec 01a amd 1981springwoods sec 02a rev 1981springwoods sec 02espringwoods sec 02fspringwoods sec 02gspringwoods sec 1a amended 1981springwoodssec 1aamended 1981sprinngwoodsprite haven boat dockssp rr cospyglassspyglass at barton creekspyglass hillsquire damon surv abs # 91s rices riggssss sanchez a-30s s farmsssi-buena vistassi paul sub welders s sanders sursszst. anthony villagest. charlesst. elmost. elmo districtst. elmo stationst.hedwigst. james placest. johns college additionst. tropez condominiumsstable gate sec 01stablewoodstablewood at slaughter creeksstablewood at slaughter creeksec 07stacey's landingst addstadium pointestaehelystaffordstafford heights southstagecoachstagecoach bus parkstagecoach hillstagecoach hillsstagecoach ph 1stagecoach ph 2stagecoach ph 3stagecoach professional center condostagecoach ranchstagecoach ranch sec 03stagecoach ranch sec 1stagecoach ranch sec 2stagecoach runstagecoach valley estates phasstage runstahl rd/pheasant ridgestahl rd/pheasant ridrgestallion creek repstallion estatesstallion estates 2stallion estates 3stallion lane estatesstallion ridge estatesstallion runstallion run un 3stallion spgsstallion spgs 2stallion spgs 3stallion springsstandifer, elizabethstandifer, jamesstandifer, williamstanding rock diamond ranchst andrewsst andrews; lakewaystanhope placestanley wilsonst anthony villagest anthony village sec 02st anthony village sec 03stanton runstanton vistasstaplesstar countrystar crossingstardust iistargatestargazerstargazer ranchstark addstarke farmsstarkfield rep pt blk 02stark frankstark jeromestarlight estatesstarlight ranchstarlight ranch subdivionstar light terracestarlight terracestarlight villagestarlit hillsstarlit hills/n.shearerhlsstarlit hls/n.shearerhlsstar oaks ranchstar ranchstar ranch ph 2 sec 7star ranch ph 3 sec 7star ranch ph 4 sec 7star ranch ph 6 sec 7star ranch ph 7 sec 7star ranch prcl 23star ranch sec 01star ranch sec 02star ranch sec 7 ph 2star ranch sec 7 ph 3star ranch sec 7 ph 4star ranch sec 7 ph 5star ranch sec 7 ph 6star ranch sec 22 condosstartzvillestar west condostar west condosstarwest condosstassney lane condo amdstasswender addstation at st elmostation at st elmo condosstation at st elmo the condominiumsst charles condo amdst charles condominiums amenst charles condominiums amendedst charles place sec 01st delightsteck e lsteeds crossingsteele creeksteele creek sub #1steele creek sub #8steele creek unit 1steel house loftssteel valleysteelwood traisteelwood trailsteelwood trailssteelwood trail un 3steelwood trlssteelwood trl un 5steeplechasesteeplechase/davenport condossteeplechase condo nesteeplechase condossteeplechase gardenhomes amdsteeple chase ph 03 sec 03steeplechase phase iii sec 3steeplechase sub ph isteeplechase sub ph iisteeplechase sub ph iii sec 1steeplechase sub ph iii sec 2-bsteeplechase sub ph iii sec 3steeplechase sub ph iii sec 4steeplechase sub ph iii sec 5stefek trust addition phase fourstefek trust add ph fostegersteger addstegman ranchsteiner ranchsteiner ranch, river dance ph 04steiner ranch, river dance ph 05steiner ranch casitas sub-condsteiner ranch parksidesteiner ranch ph 01 sec 01steiner ranch ph 01 sec 02-asteiner ranch ph 01 sec 04bsteiner ranch ph 01 sec 04csteiner ranch ph 01 sec 04dsteiner ranch ph 01 sec 04esteiner ranch ph 01 sec 04gsteiner ranch ph 01 sec 05asteiner ranch ph 01 sec 05csteiner ranch ph 01 sec 06bsteiner ranch ph 01 sec 06dsteiner ranch ph 01 sec 06esteiner ranch ph 01 sec 06fsteiner ranch ph 01 sec 06gsteiner ranch ph 01 sec 08steiner ranch ph 01 sec 09steiner ranch ph 01 sec 7asteiner ranch ph 01 sec 7bsteiner ranch ph 01 sec 8esteiner ranch ph 01 sec 10asteiner ranch ph 01 sec 10bsteiner ranch ph 01 sec 10csteiner ranch ph 02 sec 03-bsteiner ranch ph 02 sec 03-dsteiner ranch ph 02 sec 04asteiner ranch ph 02 sec 04csteiner ranch ph 02 sec 04dsteiner ranch ph 1 sec 6g residencesteiner ranch ph 6-bsteiner ranch phs 1 sec 5bsteiner ranch phs 1 sec 9steiner ranch phs 1 sec 10bsteiner ranch river dance ph 02steinle addstengerstephen f. austinstephenson sec iiistephenvillesterling acressterling creststerling crest condosterling crest condo amsterling c robertson sur a-52sterling meadowssterling oakssterling ridgesterling shoresstetson ridgesteubing farmsteubing farm-jv bacon pkwysteubing farmssteubing farm ut-7 (enclave) bexarsteubing ranchstevens ranchstewartstewart, john cstewart acresstewart annie sec estewart b kstewart crossingstewart jstewart xing ph 2st hedwigsthedwigst hedwig additionstillforest substillhouse canyon condostillhouse canyon condo amdstillhouse canyon condo amendedstillwaterstillwater ranchstillwater ranch 3stillwater shoresstillwood estatesstinnett millstinnett mill estatesstinnett millsstirling bridgestirling bridge sec 01stirling bridge sec 02stirling bridge sec 03stirling bridge sec 4stirling bridge sec 5stirling bridge sec 6st james condominiums amendest john's home addnst johnsst johns collegest johns college addst johns college addnst johns home addstockbauer at cimarron strip sstockdalestockdale bus parkstockmenstolle grove addn smstonebridgestonebridge crossingstonebridge crossing un 1stonebridge crossing unit 2stonebrookstonebrook estatesstone canyonstone canyon sec 03stone canyon sec 04stone canyon sec 05astone canyon sec 06bstone canyon sec 06cstone canyon sec 07bstone canyon sec 08astone canyon sec 08cstone canyon sec 7-astone creekstone creek ranchstonecreek unit1stone creek villagestonecrest at lookout castone crk ranchstonefieldstonefield (ns)stonefield estatesstonefield sec eightstonefield sec fourstonefield sec onestonefield sec tenstonefield sec twelvestonefield sec twostone gardenstone gatestonegatestonegate 02 condosstone gate 1stone gate 3stonegate at cat hollow office condostonegate at dripping spgsstonegate hillstonegate iistonehaven/cedar parkstonehaven enclavestonehedge 2stonehedge estatesstonehedge sec 01stonehedge sec 02stonehillstonehill sub ph 2stone house estatesstoneirdgestone lake trailsstone lea riverfrontstoneledge 02stoneledge 02 condo ph 01stoneledge acresstoneledge condo ph 01-02stoneleigh condostoneleigh condo amdstone lk trlsstone mountainstone mountain/ridgewoodstone oakstone oak at round rockstone oak at round rock sec 04stone oak meadowsstone oak parkestone oak villasstone ridgestoneridgestone ridge mountainstoneridge sec 1stoneridge sec 2stone springs estatesstones throw condostone valleystone valley ph 1stonewallstonewall estatesstonewall ranchstonewall ranch-north sec 9stonewall ranch-north sec 13stonewall ranch 40stonewall ranch 40' alleystonewall ranch 50stonewall ranch northstonewall ranch sec 02stonewall ranch sec 03stonewall ranch sec 07stonewall ranch sec 5stonewall ranch sec 6stonewall ranch sec eightstonewall rdg ph iistonewall ridge ph istone waterstonewaterstonewater north ph 2stonewater north ph 3stonewater ph 01stonewater ph 1-astonewater ph 2stonewater ph 3stonewater ph 4stonewater ph 5stonewater ph 6stonewater ph 7stonewater ph 8stonewoodstonewood commonsstoney brook sec 03 a repstoney brook sec 03a repstoney brook sec 04stoney chasestoney creekstoney creek villasstoney creek villas condo amdstoney farmsstoney rdg hlnds ph 1stoney rdg ph c sec 3stoney ridgestoney ridge northstoney ridge ph a sec 03bstoney ridge ph a sec 03cstoney ridge ph b sec 01stoney ridge ph b sec 02stoney ridge ph c sec 2astoney ridge sec 05-bstoney ridge sec 5 bstoney woodstonledge acresstony pointstork additionstorms sur 641stout realty co inside bl 3895stoval, geo hstow it addition & stringer additionstrapper wingard ranchstratfordstratford add third extstratford fifth extstratford hills sec 03stratford placestratford place phase vistratford place ph istratford place ph viistrattonstrawberry fieldsstrawberry fields subdivisionstream watersstreetmanstring prairie acresstringtown acres substrodestroud a surst thomas condo amdst thomas condominiums the amendedst thomas condos bldg ast tropezstubblefieldstubblefield add to blmtstudio estatesstudio estates sec 1studio estates sec 2astudio estates sec 2bsturm parkest williams churchstyles j fowlersubdivision 1430subdivision namesubdivision of the southsuburban oaks estatesuburban oaks estatessuburbia estatessueann suburbsugar loaf estates addsugar loaf estates add 3rsugar loaf estates add fisugar loaf estates add sesuhlerssummer's millsummercrest sec 01 revsummer crest sec 02summer crest sec 03summer crest sec 04summerfieldsummerfield townhomessummerglensummerhillsummer home addsummer home add bl 5001summerlinsummerlin estatessummerlynsummerlyn ph l-1asummerlyn ph l-1bsummerlyn ph l-4summerlyn ph l-5summerlyn ph l-6summerlyn ph p-3asummerlyn ph p-3bsummerlyn ph p-4asummerlyn ph p-5bsummerlyn ph p1summerlyn property owners associationsummerlyn south sec 1summerlyn westsummerlyn west sec 1summerlyn west sec 4 & 5summer moonsummer mountain ranchsummer mountain ranch sec 1summer mountain ranch sec 2summer pointsummer pointe sec onesummerrowsummersidesummer sun subsummertree condosummerwindsummerwind townhome condo amdsummerwoodsummerwood 2summerwood 4summerwood 8summer wood sec 01 amdsummer wood sec 03 01 resubsummit/lk travis residential csummit/lookout enclave ncb 140summit addsummit addnsummit at alamo ranchsummit at bulverde creeksummit at lake travissummit at lookout enclavesummit at rivery parksummit at rivery park (brownstones)summit at university hillssummit condo amdsummit cordova #1 thesummit cordova #3 thesummit crossing ph 3bsummit estate at fischer texassummit estates at fischer 1summit estates at fischer texassummit hillsummit northsummit north ph 1summit north ph 2summit north ph 4summit north ph 5summit oakssummit oaks annex sec 03 ph 02summit oaks sec 02summit of lost creeksummit orchardsummit ph 1summit ph 2summit ph 4summit ph 6summit ph 7summit ph 10summit phase 1summit ridgesummit rocksummit spgssummit spgs ranchsummit springssummit springs ranchsummitt comalsummy addsun chasesunchase condo amdsunchase condominiumssunchase condominiums amendesunchase condominiums amendedsun chase estates ph foursun chase estates ph onesun chase estates ph threesun chase south sec 2sun chase south sec 4sun chase south sec 8sun chase xxiii condossun chase xxxi condossun citysun city georgetownsun city georgetown 87sun city georgetown amd placesun city georgetown nbhd 47 pusun city georgetown nbhd 47 pudsun city georgetown nbrhdsun city georgetown nbrhd 05-b amd placesun city georgetown nbrhd 14asun city georgetown nbrhd 20sun city georgetown nbrhd 24 bsun city georgetown nbrhd 26sun city georgetown nbrhd 47sun city georgetown neighborhood 02 amd bsun city georgetown neighborhood 03sun city georgetown neighborhood 04sun city georgetown neighborhood 05b amdsun city georgetown neighborhood 06 amd bsun city georgetown neighborhood 07sun city georgetown neighborhood 08a pud blksun city georgetown neighborhood 7sun city georgetown neighborhood 12a ph 02 pusun city georgetown neighborhood 14a & 14b pusun city georgetown neighborhood 18 pudsun city georgetown neighborhood 19 pudsun city georgetown neighborhood 23 pudsun city georgetown neighborhood 24 b2 pudsun city georgetown neighborhood 24a pudsun city georgetown neighborhood 24b pudsun city georgetown neighborhood 25 pudsun city georgetown neighborhood 26 pudsun city georgetown neighborhood 30 pudsun city georgetown neighborhood 31 pudsun city georgetown neighborhood 32 pudsun city georgetown neighborhood 33 pudsun city georgetown neighborhood 35 ph 03 pudsun city georgetown neighborhood 36 ph 03 pudsun city georgetown neighborhood 38 pudsun city georgetown neighborhood 40 pudsun city georgetown neighborhood 41 pudsun city georgetown neighborhood 42 pudsun city georgetown neighborhood 43 pudsun city georgetown neighborhood 46 pudsun city georgetown neighborhood 47 pudsun city georgetown ph 01 neighborhood 08b pusun city georgetown ph 02 neighborhood 09 pudsun city georgetown ph 02 neighborhood 10 pudsun city georgetown ph 02 neighborhood 12-b psun city georgetown ph 02 neighborhood 13b blsun city georgetown ph 02-asun city georgetown ph 02a neighborhood 11 pusun city georgetown ph 04a neighborhood 15 pusun city georgetown ph 04a neighborhood 16a psun city nbrhd 64sun city nbrhd 66 92sun city nbrhd 67sun city nbrhd 68sun city nbrhd 72sun city nbrhd 75sun city nbrhd 77sun city nbrhd 78sun city nbrhd 83sun city nbrhd 84sun city nbrhd 86sun city nbrhds 81 82sun city nbrhds eighty-one & esun city nbrhd sixty-six & 92sun city neighborhoodsun city neighborhoodssun city neighborhoods eighty-sun city neighborhoods eighty-one & esun city texassun city texas nbrhd 50sun city texas neighborhod 59sun city texas neighborhood 13sun city texas neighborhood 13 ph 02 pud blksun city texas neighborhood 48 pudsun city texas neighborhood 51 pudsun city texas pud nbrhd 56sun city texas pud nbrhd 59suncreek estates sec 1-2sundancesundance crossingsundance crossing, ross road subdsundance estatessundance ranchsundance ranch northsundance ranch north ph 02sundance ridgesundance squaresunday creek at kinder ranchsundown acressundown ranchsundridge park sec onesunfieldsunfield 40'ssunfield ph 5 sec 3sunfield phase four sec one asunfield phase one sec fivesunfield ph five sec foursunfield ph five sec ninesunfield ph five sec one bsunfield ph five sec sevensunfield ph five sec threesunfield ph five sec twosunfield ph four sec one asunfield ph four sec three asunfield ph four sec twosunfield ph one sec onesunfield ph one sec sixsunfield ph one sec twosunfield ph three sec five bsunfield ph three sec five csunfield ph three sec foursunfield ph three sec six asunfield ph three sec six bsunfield ph three sec threesunfield ph three sec twosunfield ph two sec eightsunfield ph two sec elevensunfield ph two sec fivesunfield ph two sec foursunfield ph two sec ninesunfield ph two sec sevensunfield ph two sec sixsunfield ph two sec tensunfield ph two sec twelvesunfield ph two sec twosunflower acressunflower aressunflower beachsunflower beach condominiumssunflower beach pudsunflower estates ph fivesunflower estates ph onesunflower estates ph sixsunflower estates ph threesunflower estates ph twosunflower ridgesunflower valleysungatesungate communitysunilandings ph isun meadows ph 02sun meadows ph onesun meadows ph threesun meadows ph twosunny meadowssunnyvalesunnyvale villas a condosunridgesunridge condossunridge parksunridge park sec 01sunridge park sec 1sunrisesunrise 1st extsunrise acressunrise additionsunrise baysunrise bay sdsunrise beachsunrise beach agsunrise beach unit 2asunrise beach unit 2bsunrise beach unit 3sunrise beach unit ll bsunrise beach villagesunrise canyonsunrise condossunrise condos un 2sunrise countrysunrise hills ph isunrise meadowssunrise meadows unrecordedsunrise mountain ranchsunrise parksunrise subdivisionsunrise terracesunrise villagesunrise vistasunrise vista sec 02sunsetsunset (ns)sunset-city ccsunset acressunset addsunset baysunset bay poasunset canyonsunset canyon sec 1sunset canyon sec 4sunset canyon sec i-csunset canyon sec iisunset canyon sec ii-csunset canyon sec vsunset cliff estatesunset cliff estatessun set estates phs 1 replat osun set estates phs 4sunset estates ranchsunset heightssunset hill enfield 02sunset hillssunset hills ph onesunset hills ph twosunset hill sub 2nd amdsunset oakssunset oaks sec 1 ph 2sunset oaks sec 4 ph 1asunset oaks sec 4 ph 1bsunset oaks sec 4 ph 2asunset oaks sec 4 ph 2bsunset oaks sec 4 ph 3asunset oaks sec 4 ph 3bsunset parksunset rdg subsunset ridgesunset ridge estatessunset shadowssunset shadows ph #1sun set terracesunset terracesunset trailsunset trail condos ph 2sunset valleysunset valley meadowssunset viewsunset view sec 03sunset villagesunset villassunset villa subsunset vista sub sectisunshadow cove ph threesunshinesunshine estatesunshine meadow subsunshine meadow sub fisunshine parksunshine park estatesun terracesunterra sec 73sun valleysun valley 2sun view ranchettessur 3 harrisonsur 4 gorhamsur: s a & m g rrsurfsidesurfside beachsurfside townsite sub c sec 3surveysusie & martin cuellar subsutherland hills estatessutherland sdsutherland springssutherland springs new townsutherland surveysuttonsutton farmssutton farms subsutton placesutton place ph five firstsutton place ph five sectiosutton place ph five section one & two, bl 003, lot 0005suzannsvsvobodaswan point landingsweswede hill condominiumssweeney ranchsweetbriar condossweetbriar garden homes condomsweetbriar villagesweet homesweet home estatessweetman r l addsweetwatersweet water crossingsweetwater crossingsweetwater crossing townhomessweetwater glen condo amdsweetwater ranchsweetwater ranch sec 1 villagesweetwater ranch sec 1 village l psweetwater ranch sec 2sweetwater ranch sec 2 villagesweetwater ranch sec 2 village bsweetwater ranch sec 2 village p3asweetwater ranch sec 2 vlg bsweetwater ranch sec 2 vlgs csweetwater ranch sec 2 vlgs c&sweetwater ranch vlg n sec 2sweetwater sec 1 village g-1sweetwater sec 1 village g-2sweetwater sec 1 village h2sweetwater sec 2 village f1sweetwater vlgs c&d sec 2swenson farmsswenson farms condosswenson farm single family phswenson farm single family ph bswenson farm single family phs c1swenson heightsswenson heights sub un 3aswenson heights sub un 3bswenson heights sub un 3cswi-bswickheimersw irrigated farms (sw)sw irrigated farms swswisd acreage swswisher addswiss alpine villageswiss alpine village sec 02swiss villageswwsycamore creeksycamore detached condosycamore falls estatessycamore valleysydney covesykes addsylvester addsylvia heightssypert school road estates repsyphrett estatessy reamssyrinx condot002d54i - cty taylor thorndale rd & acreage tractt13mh -historical cbd retail - taylort13sg-service garage-taylort13tr - taylor transitionalt13tr2 - taylor transitional 2t14tr1 - hutto transitional 1t501d29i - cty taylor south varioust541 - h1 & h2t601llli - sco abstracts, vacant landt7053501-sco-couplandtabberertabor addtafttahitiantahitian u5tahitian villagetahitian village,tahitian village, unit 1tahitian village, unit 2tahitian village, unit 4tahitian village, unit 5tahitian village poatahitian village unit 02tahitian village unit 03tahitian village unit 04tahitian village unit 05tahitian village unit 1tahitian village unit 2tahitian village unit 4tal-coetal-coe placetalaveratalavera ph 1talavera ph 2talavera ph 3talia subtalise de culebratalley fieldstallgrass medical &professionatallgrass medical & professional office condominiutall oaks subtall timberstallwood condo amdtamarack mountain sec itamarack shorestamarack shores 1tamarack shores 2tamarontamaron passtammtangelwoodtangerine iitanglewoodtanglewood / shorestanglewood add sec 2tanglewood estatestanglewood estates ivtanglewood foresttanglewood forest sec 01 ph btanglewood forest sec 01 ph ctanglewood forest sec 02 ph atanglewood forest sec 02 ph btanglewood forest sec 02 ph ctanglewood forest sec 02 ph dtanglewood forest sec 02 ph etanglewood forest sec 03tanglewood forest sec 04 ph atanglewood forest sec 04 ph btanglewood forest sec 04 ph ftanglewood forest sec 05tanglewood forest sec 08tanglewood forest sec 3tanglewood forest sec 8tanglewood iv resub 1tanglewood north 4th unit 1sttanglewood north 6th unittanglewood north 9th unittanglewood north second unittanglewood north seventh unittanglewood north sub-divtanglewood sec viii resubdtanglewood sec vi resubd 3tanglewood shorestanglewood xtannehilltanner ranchtapatio springstaratarasco gardenstarod philip town homes sec 1tarpleytarrow townhomestarry town 02tarry town 05tarry town 06tarry town 07tarry town no 5tarrytown oakstarrytown place condominiumstarrytown terrace condotaulbee place condotausch farmstaylortaylor & smithtaylor citytaylor city oftaylor city of, block 9, lot 5-6, 1-4(s/pts), acretaylor city reptaylor east duplextaylor estates sec 01taylor old towntaylor ranchettestaylorstaylor smithtaylor transitional 2taylor v e second subdt bar m ranch estates 1t bar m ranch estates 2t bar m ranch estates it bar m ranch ests.t bar m tennis rancht bar m tennis ranch 2t bar m tennis ranch 4tbdtc r prt c rr co survtcttech ridgetecolote ranchtejas pointetelfernertemki centertempletemple heightstemple heights iitemple originaltemple park estatesten acres sub sectennessee colonytennessee valley estatetenney creek estatestenney creek ranchtenney creek ranchestenney crk ranch subten thousand north lamarteravistateravista sec 01 & 02teravista sec 07teravista sec 08teravista sec 09teravista sec 10ateravista sec 11teravista sec 13bteravista sec 14bteravista sec 15ateravista sec 15bteravista sec 16ateravista sec 16bteravista sec 17ateravista sec 18bteravista sec 21teravista sec 22teravista sec 23teravista sec 26bteravista sec 27teravista sec 313 ph 1teravista sec 313 ph 2teravista sec 313, ph 2teravista sec 322a ph 2teravista sec 323 ph 2teravista sec 325teravista sec 326teravista sec 327teravista sec 328teravista sec 330teravista sec 401 ph 2teravista sec 402teravista secs 311teravista secs 322b & 323teravista sermon 326terlingua ranchterra bellaterra briggsterraceterrace 09 condo amdterrace acres addterrace at the preserve condomterrace gardens first unitterrace gardens second unitterrace mountainterrace on shoal creekterrace parkterrace plazaterracesterraces at alamo ranchterraces at bentwood ranchterraces at encino pterrace west sdterra colinasterra colinas ph 1terra colinas ph 2terra fallsterralterral heights #1terral heights #2terrallterralomaterra montterra mont subterra view townhomesterravistaterra vista subterra vista sub ph 2terra vista sub ph iiiterra vista sub ph vterra vista sub ph viterra vista sub ph vii-aterra vista sub ph vii-bterrazas at alamo heightsterrell heightsterrell hill condo amdterrell hillsterrell hills neterrell terraceterrytowntesoro hillstesoro ridgetesoro ridge subtesoro section 3tesoro sub secs 2 & 4tesseratessera/lk travis ph 1atessera/lk travis ph 1b1tessera/lk travis ph 1b2tessera/lk travis ph 3a1tessera/lk travis ph 3a2tessera/lk travis ph 3a3tessera/lk travis ph 4atessera on lake travistessera on lake travis ph 1atessera on lake travis phs 1atexana terracetexan gardens - sljtexan shoal creektexan shoal crk condostexan shoel creektexan towertexan tower condo amdtexan tower condominiumstexan tower condostexas central railway co survtexas central zonetexas citytexas country estatestexas country estates 1texas grand ranchtexas gulf rv park, poc commercial,texas hazelwood condostexas heritagetexas heritage villagetexas heritage village sec 4texas national 06texas north sub reptexas oakstexas oaks 02texas oaks 05texas oaks 06texas oaks 07-btexas oaks 9texas oaks sec 09texas research parktexas research park un 6btexas traditionstexas traditions ph 01texas traditions ph 02-atexas traditions ph 02-btexas trailstexas western narrow gauge raitexas west subtexas west sub ph ftexas west sub ph ttezel heightstezel oakstezel trailt f parrott surv abs 254thaler addtharp subthaxton placethaxton roadthe 290the 290 on the nuecesthe 1623 dividethe addiethe addie condominiumsthe allandalethe allandale condosthe alora maethea meadowsthe andythe antlers on lake lbjthe arbor at rierstonethe arbors at dogwood creekthe arbors at dogwood creek sec 2the archesthe arts residencesthe austonianthe barracksthe barracks ii ph 202the bendthe bend at post oakthe bend condominiumthe bend condominiumsthe birch at spencer ranchthe blanco river ranchthe bluff at dunns hollowthe bluff at mill creekthe bluffsthe bluffs at canyon springsthe bl uffs at round mountainthe bluffs at round mountainthe bluffs at the hollowsthe bluffs of hendersonthe bluffs of lost creekthe bluffs of lost creek ut-5bthe braxtonthe bridgesthe broadway (common) ncb 6096 (the broadway san athe broadway sa condothe brownstone at northlinethe brownstones at rivery park ph 1the brylees estatethe campus at lakewood ranch pthe canyon clubthe canyonsthe canyons at amhurstthe canyons at hch ranchthe canyons at scenic loopthe carriage house estates ofthe cascade condominiumsthe cedarsthe centurythe cliff over lake austinthe cliffs at water ridgethe colonythe colony (bandera pass)the colony - 45'the colony - 50'the colony - bandera passthe colony - coleton meadowthe colony mudthe colony mud 1a, sec 1,the colony mud 1a, sec 2athe colony mud 1a, sec 2bthe colony mud 1cthe colony mud 1c section 5the colony mud 1d sec 1 phthe colony mud 1ethe colony mud 1e, sec 1the colony mud 1e sec 2 phthe colony ph twothe colony sec threethe commons of waterford parkthe cottages at belterra villagethe cottages at high circle norththe cottages northwoods avery stationthe county line on lake nuecesthe cove at westover hillsthe covey at quail creekthe creeks at deerfieldthe creeks of salado ph ithe creeks of salado ph i rthe crestthe crossingthe crossing at kenbergthe crossing at spring creekthe crossing at wells branchthe crossing condosthe crossingsthe crossvinethe crossvine module 1 ut-1 suthe dawn condo 2006the denizen condominiumsthe districtthe dividethe docks @ pocthe dominionthe dracethe draw at rock ridgethe eastwood at riversidethe elmsthe enclavethe enclave @ canyon lakethe enclave at barton creek lakesidethe enclave at bar wthe enclave at horseshoe baythe enclave at lagosthe enclave at lake beltonthe enclave at lake belton phase iiithe enclave at lakesidethe enclave at pearson placethe enclave at sonterrathe enclave at troythe enclave at university hillsthe enclave at uvalde country clubthe enclave at whitbythe enclaves at lagosthe escarpmentthe escarpment subthe estatethe estates at deer creekthe estates at mountain springs ranchthe estates at panther creekthe estates at stone crossingthe estates at triple r ranchthe estates of barton creekthe estates of blackhawkthe estates of eagle creekthe estates of forest crestthe estates of panther creekthee viewthe fairways at canyon lakethe fallsthe farms of lytlethe fergusonthe field housethe fields of doverthe forest at colorado crossingthe forest at stone oakthe forest inwoodthe foundry condominium communitythe fountainthe fountains at deethe fountains of fair oathe frog pondthe galileo at 25 condothe gardens at castlehilthe gardens at greystonethe gardens at the summitthe gardens at urban crestthe gardens at yorkshirethe gardens of canyon oaksthe gardens of howard ranchthe gardens of howard ranch, a residential condothe garrisonthe georgianthe glenthe gordon c jenningsthe granarythe granary- heritagethe granary- villasthe granbergthe grangethe great northwestthe greens at lincolthe grotto condothe grovethe grove (grove master condominiums)the grove at blackhawkthe grove at bull creekthe grove at georgetownthe grove at lakewood ranchthe grove at vintage oaksthe grove condominiumsthe groves at lakewood ranch pthe groves at vintage oaksthe guild condominiumsthe hamletthe hamlet placethe heatherthe heather condominiumsthe heightsthe heights at saengerhallethe heights at vista parkethe heights at vista parke condominiumsthe heights at westoverthe heights iithe heights of cibolothe heights of crownridgethe heights of kerrvillethe highlanderthe highlandsthe highlands addthe highlands additionthe highlands at saegert ranchthe highlands of mill creekthe highlands of mill creek sethe highlands sec athe highlands sec bthe highlands sec cthe hillthe hillsthe hills, lakeside and the greensthe hills/sierra norththe hills at sharylandthe hills at sonterrathe hillsidethe hills of el dorathe hills of lakewaythe hills of long hollowthe hills of madronethe hills of madrone ranchthe hills of texas ph 1the hills of westcreekthe hills of westpark addthe hills of westwoodthe hollowsthe hollows canyon - 60'the hollows canyons sec 2the hollows condo hilltop vithe hollows on lake travisthe hollows phase 2the hollows sec 1the home placethe homeplace at jarrellthe homesteadthe homestead @ turtle crkthe homestead on hobbsthe homestead on hobbs creekthe homestead on hobbs creek phasethe horizonthe horizon in kerrvillethe independentthe isabella 78704the jansonthe jocey condominiumsthe journey church athe joyce condominiumthe landing at blancothe landing at clear creek phathe landing at heritage oaksthe landing at kitty hawkthe landing at lakewaythe landings at lake travisthe lane subthe lazy sandies subthe left bankthe legendsthe legends@rancho del lagothe linden residencesthe links at river bendthe links at riverbend phase onethe links at scenic hillsthelma area sothelma centrellthe lodge at creekside condothe lodge at creekside condominiumsthe lofts at st. stephensthe marian condominiumsthe meadowsthe meadows add ph ithe meadows add ph iithe meadows at budathe meadows at buda ph four-athe meadows at buda ph four-bthe meadows at buda sec onethe meadows at buda sec three-athe meadows at buda sec three-bthe meadows at buda sec twothe meadows at clear forkthe meadows at creeksidethe meadows at creekside phthe meadows at creekside ph iithe meadows at quail runthe meadows at quick ranchthe meadows phase 1the meadows phase 2the meadows ph ithe meadows ph iiithe meadows ph ivthe meridianthe modern austin residencesthe oaklandsthe oaksthe oaks at encino parkthe oaks at hill country estatesthe oaks at san gabrielthe oaks at sonterrathe oaks at stonefiethe oaks at westwood ph iiithe oaks of westcreekthe oaks ph iithe oasis at midtowntheodore heightstheodore low heightsthe old mill circletheophilus hickman 1/3 leaguethe orchard condominiumthe orchards at valley ranchthe overlook at saladothe overlook at the hills of texas estatesthe overlook at westlakethe overlook sec 1the overlook sec 2the owners club at barton creekthe parkthe park at blackhawkthe park at cimarron enclave - bexarthe park at deerfieldthe park at hardy oakthe park at harris ridgethe park at lonestarthe park at steeplechasethe park at university hillsthe park at willow creekthe parklandsthe parks at westfieldthe pelican condothe peninsula at plum creekthe peninsula on lake buchananthe peninsula on lake lbjthe pinnaclethe pinnacle at great hillsthe place property owners association, inc.the plainsthe plains at riverside phthe plains at riverside ph ivthe plazathe point at lake mcqueeneythe point at rancho del lagothe point at ridge harborthe point at rough hollowthe pointethe polo club at rooster spgs ph 3the polo club at rooster spgs ph 4the polo club at rooster spgs ph iithe poppy at vista vera condosthe porch at du prethe porch at du pre subthe powellthe prairiethe preservethe preserve @ research enclavethe preserve at alamo ranchthe preserve at candlemeadowthe preserve at chula vistathe preserve at chula vista ranchthe preserve at elm creekthe preserve at hidden trailsthe preserve at indian springsthe preserve at lakewaythe preserve at la ventanathe preserve at la ventana ph threethe preserve at la ventana ph twothe preserve at mayfield ranchthe preserve at singing hillsthe preserve at the candlemeadowthe preserve at the dominionthe preserve at walnut spgsthe preserve at walnut springsthe preserve of mission valleythe preserve of sterling ridgethe preserve ph onethe preserve ph twothe preserve subthe provincethe quarrythe quarry at champee springsthe railyardthe ranchthe ranch at brushy creekthe ranch at florencethe ranch at iron horsethe ranch at watersedgethe ranch at windermerethe ranches at comanche pointthe ranches at creeksidethe ranches at quail ridgethe ranches at rifle ridgethe ranches at scenic ridgethe ranches at table rock ph 2the ranches at terra vista phthe ranches of colony line trailthe ranches of quail runthe ranch sec 04 (barton creek lakeside)the rangethe ravinethe renaissancethe reservethe reserve @ deerfieldthe reserve at brushy creekthe reserve at caballo ranchthe reserve at canyon springsthe reserve at euclidthe reserve at falling waterthe reserve at knoll creekthe reserve at lake travisthe reserve at legacy ranchthe reserve at saddlehornthe reserve at schertz iithe reserve at serenadathe reserve at skyline mountaithe reserve at summit rockthe reserve at summit rock/golden bearthe reserve of kensington ranchthe residences at w austinthe retreatthe retreat at blackhawkthe retreat at dripping spgsthe retreat at steiner ranchthe retreat at town centrethe retreat on willow creekthe retreat on willow creek ph 1the retreat on willow creek ph 2the retreat on willow creek ph 3the retreat on willow creek ph 4the ridgethe ridge @ iron horsethe ridge @ sonoma verdethe ridge at alta vistathe ridge at banderathe ridge at canyon springsthe ridge at cross creekthe ridge at deerfieldthe ridge at encino parkthe ridge at knob creekthe ridge at leon valleythe ridge at lookout canyonthe ridge at slaughter lanethe ridge at springwoodthe ridge at steeds crossing sec 1the ridge at stoneoakthe ridge at tapatio springsthe ridge ph threethe ridge ph two sec 1the ridge ph two sec 2the sanctuarythe sanctuary sub ph 1 pothe sanctuary sub ph 2 pothe sands of kahala beachthe settlementthe settlement @ patriot ranchthe settlement at patriot ranchthe settlement on stagecoachthe settlement patriot ranchthe settlement patriot ranchtheseventeenthe seventeen condominiumsthe sexton at springdalethe spgs at the escarpmentthe springthe springs at cordillera ranchthe springs condo amdthe square at lakewaythe stationthe station at st elmothe summitthe summit at canyon springsthe summit at cypress millthe summit at lake travisthe summit at sterling ridgethe summit at stone oakthe summit estates at fischerthe summit norththe summit of cypress millthe summit ph 2the summits subdivisionthe summitt at cordovathe sundownerthe timbersthe timbers of la verniathe towers at park lanethe trails at carmelthe trails at providencethe trails at westpointethe trails of kensington ranchthe trails of lake lbjthe trails of lake lbj ph1the upper deckthe valleythe valley at great hills phase 1the valley of great hillsthe vesperthe views at crystal fallsthe villagethe village at avery parkthe village at colovistathe village at creeksidethe village at dawson ranchthe village at inwoodthe village at judsonthe village at lincothe village at nolan heightsthe village at rustithe village of colony creekthe village of manor commonsthe village of mill creekthe village of mill creek unit 3bthe villages at stone oakthe villages of trinity oaksthe villas at braun stationthe villas at canyon springsthe villas at chandler creekthe villas at creeksidethe villas at creekside iithe villas at ingram hilthe villas at timberthe villas of northgatethe vineyardthe vineyard at rough hollowthe vineyard ph 1the vineyards at rough hollowthe vineyards of killeenthe vistas at la canterathe vistas at round mountainthe vistas of austinthe vistas of encinothe vistas of lakewaythe walshthe watersthe waters (hsb)the waters at deerfieldthe waters at horseshoe baythe waters at horseshoe bay rethe waters at horseshoe bay resortthe w austin residencesthe wilderthe willowsthe willows amdthe woodlandsthe woodlands hillsthe woodsthe woods at fair oaksthe woods of boerne subdivision - kendallthe woods of encinothe woods of saladothe woods of westcreekthiele addthiem ranchthirty 01 hundred san gabriel condothirty 01 street condo amdthirty 03 fifty 05 bee cave officethirty 08 & duval condo at hwythirty 2 hundred duval condothirty first street condominiumsthistle creekthistle creek #1bthistle creek #2thoma powell surv abs #135thomasthomas, b.a.m. sur.thomas a graves surv a-252thomas a moore surv abs #430thomas bam a297thomas b lee surv abs #403thomas b westbrook jose seferithomas b westbrook survthomas christianthomas collinsthomas eldridgethomas e shell a-557thomas e shell surv abs # 557thomas f gray surv abs #250thomas g mcgehee survthomas g mcgehee surv abs 11thomas g mcgehee surveythomas j chambers survthomas j chambers surveythomas j hattonthomas maxwellthomas maxwell surv abs 188thomas placethomas pondthomas ranch loralomathomas s saul surveythomas taylor league abs 96thomas toby surv abs #894thomastonthomas t williamson surv a-755thomison jackiethompsonthompson knappthompson ranch estatethompson subthorn add a46 llomasthornbury ii sec 3thornbury ii sec 4thornbury ii sec 6thornbury sec 01thorndalethornebrookthornebrook 1 acrethorntonthornton ranchthornton stone surv abs 733thornton trailsthoroughbred estates ph 03thoroughbred farms sec 01 amdthousand oaksthousand oaks addn ii ccthousand oaks forestthousand oaks sec 1thousand oakssec 1thousand oaks sec 2thousand oaks sec 4thousand trailsthrallthrall citythrasher lanethreadgillthreadgill ranch subthree creekthree creeksthree creeks phase ixthree creeks ph ithree creeks ph iithree creeks ph ixthree creeks ph vthree crks ph 1athree crks ph ivthree crks ph ixthree crks ph vthree crks ph vithree crks ph viithree crks ph viiithree hills apartments final platthree lakes ranchthree lakes ranch addthree oaksthree pointsthree points subthree prcl subthree riversthree thousand guadalupe placethree thousand guadalupe place condothreshold ranchthreshold ranch subt hughesthunderbird hillsthunderbird lakethunderbird villagethunder creek estatesthunder creek ranchthunder rockthunder rock marble fallsthunder rock ph 1thurman bend estatestidewater oaks subtier 01tier 2 east/water streettiermotierra bonitatierra buenatierra chicana addtierra del soltierra de vacastierra escondidatierra estatestierra lindatierra linda ranchtierra linda rch #3tierra linda subdivision phase iitierra mananatierra vistatiffany condotiffany condominiumstiki islandtildentilke & crocker-1st add ab/mbtillery squaretillery square subtilley port lavacatimbelrine parktimbercovetimber creektimber creek estatestimbercreek itimber creek sec 03timbergrove manor sec 13timberhilltimber hillstimberidgetimberidge square condo amdtimberline parktimberline terrace sec 03timberline west sec 02timberline west sec 1timber oaks northtimber oaks sec iiitimber path parktimber ridgetimberridgetimber ridge at greenbriar sectimber ridge estates ph onetimber ridge estates ph thrtimber ridge estates ph twotimbers at chase oakstimbers subtimber village amdtimberwildetimberwoodtimberwood parktimberwood subtimberwood subdtimmeron sec 1timmins, mrs w rtimmins, mrs w r (c w howery survey)tim oconnor subtimothy s arnett surv abs # 74tinoco acrestivolitj chamber abstj chambers surv 504t l 01t merrillt moniter survey 800to be determinedt o berry league a-17tobey ridgetobintobin & johnsontobin area townhomes idztobin hilltobin hill easttobin hill northtobin resub riversidetodd subtoepperwein bluffs enclavetoll 45 business parktoll brothers at briggs ranchtoll brothers at caliza reservetoll brothers at enchanted blufftoll brothers at george's ranctoll brothers at george's ranchtoll brothers at legacy at lake dunlaptoll brothers at mayfair - comtoll brothers at mayfair - comal collectiontoll brothers at mayfair - guatoll brothers at mayfair - guadalupe collectiontoll brothers at nolte farmstoll brothers at santa rita ranchtoll brothers at sunset ridgetoll brothers at thornebrooktoll brothers at windbornetoll brothers at woodland estatestollgate condo amdtom, johntomahawk trailstomas de la vegatomballtom creek acrestom creek hitom creek hills 2tom green condo amdtonkawatonkawa blufftonkawa bluff city homes condotonkawa villagetonkawa village phase 2tonkawa village phase 3tonkowan countrytop properties unit 2top ridge subtorian villagetoro estates ut-2toro grande bus condostoro grande subt o r properties iitor properties iitor properties unit 2torres t stoudouze estatestovar subtowtowering oaks estates 02tower lake estatestower meadowsdtower point condominiumstowers town lake condo amdtowhead valley estatestown & countrytown & country 02town & country estatetown/edna jackson countytown/goliadtown/gonzalestown/nixontown/waeldertown/westhofftown addtown creektown creek #1 lot 4town creek 1town creek 2town creek villagetown creek village #2town crk sub ph 3town crk sub ph 3 pddtown crk sub ph 4 pddtown easttowne laketowne park townhousestownes on tenthtowne viewtowne view estates #2townewood villagetownewood village easttown homes/crystal falls bldgtownhomes/crystal falls bldg 1townhomes at crystal falls condo bldg 1townhomes at crystal falls condostownhomes at gattistownhomes at gattis condotownhomes at katy crossingtownhomes at los indios condostownhomes at los indios condos ph 07townhomes at river fairtownhomes at riverside grovetownhomes at the porch du pretownhomes at tuscan villagetownhomes northwest hillstownhousetown lake residences condotownley subtown nixontown oakstown of kempnertown of liberty hilltown of lometatownsend farmstownside meadows northtownsite/goliadtownsite of lotttowns on cumberland condominiutownsquaretown square thtown talk ranchotownview easttown view estatestow villagetracetrace condo amdtrace condominiumtrace estatestrace sub pa 1a sec ctrace sub pa 1b sec btrace sub pa 2a sec btrace sub pa 2b sec btrace sub pa 2b sec dtrace sub pa 2c sec btrace sub pa 6a sec dtrace sub pa 6c sec dtrace sub pa 13 sec etrace sub sec a, pa 1a ph a-1trace sub sec a, pa 2a ph atrace sub sec a pa 1a ph a-2trace sub sec a pa 2b ph atract 2tract 2- 12.11 acrestract 80tract 1514tract 1514btract a 2.59actract pt 7traditions at vizcayatrailstrails/leander condostrails/thousand oaks sub ph 1trails @ kensington ranchtrails at alamo ranchtrails at blackhawktrails at carmeltrails at carriage hills 1trails at carriage hills sec 2trails at carriage hills sec 3trails at culebratrails at helotestrails at herff ranchtrails at leandertrails at leander condotrails at stoney ridgetrails at westpointetrails at wildhorsetrails at windy hill ph 3trails at windy hill ph 8trails endtrails end lake travistrails end ranchtrails end resub 04trailside at the ranch at brushy creektrailside oakstrailside oaks townhomwtrails kensington ranch #2trails of briggs ranchtrails of briggs ranch mdtrails of herff ranchtrails of kensington ranchtrails of santa fetrails of shady oaktrails ph 01btrails phs 1b thetrails sub ph 1btrailwoodtrailwood village travis countrytrammeltrammel revtranquility parktranquilo baytrautwein parktravenatravesiatravesia subtravis cooke road add 02travis countrytravis country westtravis country west sec 02travis country west sec 1travis estatestravis flatstravis green condotravis heightstravis heights condo the amdtravis heights terrace condomitravis hollow sec 02travis lakesidetravis lakeside ph 01travis landingtravis landing 02 ph 01travis landing 02 ph 03travis landing 02 ph 05travis oakstravis oaks condo amdtravis oaks sec 01travis oaks sec 02travis oak trailstravis plazatravis settlementtravis settlement sec 02travis settlement sec 03travis settlement sec 04travis settlement sec 06travis settlement sec 07travissotravisso - capri collectiontravisso - florence collectiontravisso - naples collectiontravisso - siena collectiontravisso - verona collectiontravisso ph 2 sec 1atravisso ph 2 sec 1ctravisso ph 2 sec 1dtravisso ph 2 sec 1ftravisso ph 2 sec 1ltravisso ph 2 sec 1mtravisso ph 2 sec iktravisso ph 2 secs 2c 2d & 2etravisso ph 2 secs 2f 2g & 2htravisso ph 3 sec 1 3travisso ph 3 sec 2travisso ph 3 sec 4travisso ph 3 sec 5travisso ph 3 sec 6travisso ph 3 sec 8travisso ph 3 secs 1 & 3travisso ph 4 sec 1 2 & 3travisso ph 4 sec 1-3travisso ph 4 sec 5travisso ph 4 sec 6atravisso ph 4 sec 6btravisso ph 4 secs 1 2 & 3travisso ph 4 secs 9 & 10travisso ph 4 secs 9 &10travisso ph 4, sec 6a - capri collectiontravisso ph 5 sec 1travisso ph 5 sec 2travisso sec 1 ph 1travisso sec 1 ph 2travisso sec 1 ph 2 / grand mesatravis southwesttravis southwest/grittentravistatravis waterfronttreadwell add sec 01treadwell add sec 02treadwell add sec 03treasure islandtreasure oaks estatestreehouse condotreehouse condominiumstreemont ph a sec 01tree ridge estatestreetopstreetops subdtres laurelstres palacios oaks subtres tierrastres vistatri- oak estatestri-oaks estatestrianatriangletribute ranchtrigg & merrelltrigg & merrell, blk 1, lot pt 1 & 18' abandone sttrilogy grovetrimmier estates ph fourtrimmier estates ph onetrimmier estates ph one reptrimmier estates ph twotrinitytrinity-brazos areatrinity add resubtrinity add revtrinity covetrinity gattis office condominiumstrinity meadows subtrinity oak arborstrinity oakstrinity oaks at round mountaintrinity oaks preservetrinity oaks preserve/round motrinity oaks preserve/round mountaintrinity oaks preserve at round mountaintrinity oaks un 1trinity place 01 amd addtrinity ranchtrinity ranch ph 1 sec 2trinity ranch ph 1, sectrinity square condominiumstrinity square condostrio/menchaca condos bldg 2triple 3 ranchtriple 7 river estates sectriple c ranchettestriple creek ranch sec 1triple mtriple oakstriple peak ranchtriple peak ranch estatestriple peak ranch estates 2triple r ranchtrophy oakstrophy oaks 2trophy ridgetropical acrestropical hideawaytroytroy originaltru-mar subdivisiontruman heightstrumbal townhomestrumbot r witten surt s c industries subtuckertuletatull addtumbleweed estatestumbleweed estates ph 3tumbleweed estates subtumlinson s/dturkeyturkey creekturkey creek estatesturkey creek estates sec 3turkey hollowturkey runturkey treeturkey tree estatesturnberry/avery ranch condos bturnberry at avery ranchturnbo ranchturnbo ranch ph 3turnbo ranch ph iturnbo ranch ph iiiturnerturner's crossingturner's crossing 50sturner's crossing phs 1turner's villageturner-clinton-turner addturners crossingturners villageturners xing north ph 1turners xing north ph 2turning stoneturning stoveturtle bendturtle bend iiturtle bend ivturtle creekturtle creek enclaveturtle creek estates sec 01turtle creek parkturtle creek villageturtle creek village ph 02 sec aturtle creek village ph 03turtle creek village ph 08turtle crk ph iturtle crk village condos bldg 1turtle crk village condos bldg 27turtle crk village ph 4 sec bturtle rock estatesturtle rock estates, lot 52tuscan oakstuscan ridgetuscan river ph ituscan villagetuscan village at summit rocktuscan village horseshoe baytuscan vlg horseshoe baytuscanytuscany heightstuscany hillstuscany meadows ph 1tuscany meadows ph i amendetuscany sec 1c ph 2tuscany sec iatuscany villastwelve oaks condo amdtwenty-two hillstwenty 01 hundred san gabriel condotwenty 03 hundred leon condotwenty 04 o 08 enfield condotwenty fifteen monarch officectwenty five hundred enfield cotwentyone24 condo amdtwenty three twenty five business park lot 1 blk 1twilight condominiums at goodnight ranchtwin bluffstwin caverns ranchtwin caverns ranch phs 2twin caverns ranch phs 2 lot # 202twin caverns ranch phs itwin creektwin creek add sec thtwin creek add sec twtwin creek farmstwin creek farms ph 01twin creek park sec 02twin creek ranchtwin creekstwin creeks - sunset ridgetwin creeks cc sec 08twin creeks country club sec 06atwin creeks country club sec 07twin creeks country club sec 2twin creeks country club sec 4twin creeks country club sec 5twin creeks country club sec 6twin creeks country club sec 10a reptwin creeks subtwin creeks subdivisiontwin forkstwin forks estatestwin isletwin islestwin lake hillstwin lake oaks subtwin lake ranch estatestwin lakestwin mesatwin mountain estate #4twin oakstwin oaks addtwin oaks estatestwin oaks subtwin peaks ranchestwin sister estatestwin sisters estatestwin spgs sec 01twin springs sec 03atwin valley terracetwin willow farmtwisted creek ranchtwisted oakstwo 01two creekstw pierce's addtylertyler subdivision/sabinaltyler tap r co surv #199 abs #tyndalltyndall/robertson hilltyndall/robertson hill condostyndall at robertson hilltyndall at robertson hill condominiumsuecker tr unit-3uhlanduhland estatesulitulit h add 02ulit h addn 02ununcertainundefinedunderhill first addunderhill fourth addundeterminedunicorn heightsunicorn heights ext 2unicorn heights nw extunidad acresunion park ph 6b-2union park westunion park west condominiumsunion park west condosunity subuniversal cityuniversal heightsuniversity heightsuniversity heights ph 1university hillsuniversity hills sec 01university hills sec 02 ph 02university hills sec 02 ph 03university hills sec 02 ph 05university hills sec 03 ph 01university hills sec 03 ph 02university hills sec 04 ph 03university hills sec 04 ph 04university hills sec 1university hills sec 2 phs 3university hills sec 3 phs 1university hills villageuniversity hills westuniversity oaksuniversity parkuniversity park sec 1university park unit 2university park unit 2 sec 1 ph auniversity park unit 2 sec 1 ph cuniversity park unit 2 sec 1 ph duniversity park villasuniversity park villas condouniversity placeuniversity place @ cs condosuniversity place twnhms bldg 1university san antoniouniversity terraceuniversity villageuniversity village north sec 6university vlg north sec 6unkunknownunkownunkwownunplattedunt 2 909 philco site condominiumsunt 141 bld z coppertree condominiums phs v amendeunt 1609 44 east ave condominiums plus .2172 % intu own warehouse & shopuplandsuplands ph 01uplands ph 02uplands ph 1 the rep of loupper east endupper elgin estatesupper reiley rdupson heightsurban heightsurbantkeurban townhomes on oliveurrutia subututopiautopia heightsut speedwayuvaldeuvalde estate #2uvalde estatesuvalde southuvitav. w. swearengenvailvail sec 02valenciavalencia condovalencia hillsvalencia hills enclavevalencia nevalencia park enclavevalentine garcia surv abs #17valentine ranch medivalero estatesvalero estates 1valero estates 2valle del rio addvallejovalle san jose add sec 01valle solvalle verde beachvalle vistavalleyvalley/great hills ph 1valley/great hills ph onevalley at great hillsvalley at great hills, phase onevalley creek ranchesvalley forestvalley forgevalley hivalley hi iii nsvalley hi ns/swvalley lake hills sec 01valley millsvalley oakvalley oaks ranchvalley ranchvalley ranch - bexar countyvalley ranch add ph ivalley ranch add ph iivalley ranch enclave un 3bvalley ranch un 7avalley ranch un 7bvalleyridgevalleyside place condovalley springvalley viewvalley view acres revvalley view acres revisedvalley view addnvalley view addn 1st extvalley view enclave condominiuvalley view ranchvalley view subvalley view third extvalley view village condovalley view westvalleyview westvalley vistavalley vista eastvalley vista ph 1valley vista ph i finalvalnetine ranchvalor estatesvalps subval verdevalverdeval verde #2val verde, parkland villageval verde 2valverde sec 1valverde sec 1 & ph 1 &2valverde sec 1 ph 1 & 2van acresvancevances addvan cleavevan cleave modernvandalevanderbiltvanderbilt condo amdvanderpoolvanderveer/ alexandervanishing texasvanstory sub #1vantagevaquero passvaquero pass ranchvaquero vistavarelmanvargasvaught ranch sec 2velasquezveltvenado creekvenado crossingventanaventana - 60'ventana condo amdventuraventura heightsveramendiveramendi acresveramendi oaksveramendi precinctveramendi precinct 13veramendi precinct 13 un 1veramendi precinct 13 un 2veramendi precinct 13 un 3veramendi precinct 13 un 6veramendi precinct 14 un 1veramendi precinct 14 un 3veramendi precinct 15averamendi precinct 15a un 1veramendi precinct 16 un 1verandaverandas/52nd condos bldg 3verandas at 52nd condominiumsverandas at the rimverandas at uptown condoverandas on berkman condominiuverandas on berkman condominiumverandas on berkman condominiumsverano farmsveranta iiverde heights at lost creek coverde hillsverde mountain estatverde mountain estatesverdi acresverdi acres subdivisionvernon addveronaverona sec 1verona sec 2verona sec 3verrado condominiumsversailles condo ahversante canyonversante canyon homes condoversevespervesper condominiumsvesper zoppp addveterans estatevicksburg villagevicky allen subvictoriavictoria christian school subvictoria courtsvictoria glen amdvictoria heightsvictoria manorvictorian oaksvictorian village ivictorian village iivictoria plazavictoria resubvictoria square condovictory gardens second secvictory heights add ncb 2238victory hill condovictory ii baptist church addnvictory ranchvictory ranch ph 1vidavidorravienna woods sec iiview at steiner ranchview at steiner ranch condominviewpoint at williamson creekviewpoint at williamson creek ph 01viewpoint at williamson creek phs i thevilla-ramavilla bordeaux condosavilla coronadovilla courtvilla de la pesca condovilla del solvilla dijonvilla dijon condovilla dijon condominiumvillaevilla estatesvillagevillage #1village #3village #4village/basel condosvillage/leander station ph 1 &village/ledge stone condosvillage/manor commons ph 1village/manor commons ph 2village/manor commons ph 4village/manor commons ph 5village/mayfield ranch ph 02-bvillage/mill crk un 2village/mill crk un 3bvillage/mill crk un 4village/mill crk un fourvillage/nolan heightsvillage/nolan htsvillage/northtown sec 3village/wells branch sec 2village/western oaks sec 15-avillage 01 at anderson millvillage 02 at anderson millvillage 02 river bend pudvillage 09 at anderson millvillage 10 at anderson millvillage 13 at anderson millvillage 14 at anderson millvillage 16 at anderson millvillage 16/anderson millvillage 17 at anderson mill ph 02village 18 anderson millvillage 19 at anderson mill ph 02village 22 at anderson mill ph 02village at baselvillage at clear springs - guadalupe countyvillage at elm creekvillage at encino parkvillage at kinney courtvillage at kirby springsvillage at leander stationvillage at ledge stone condovillage at manor commonsvillage at mayfield ranchvillage at mayfield ranch ph 03village at mayfield ranch ph 04village at mayfield ranch ph 2avillage at mayfield ranch ph 2bvillage at meadow woodsvillage at mineral springsvillage at nolan heightsvillage at pleasant valley secvillage at pleasant valley sec 01 amdvillage at quail creekvillage at quail creek sec 02village at springtown condosvillage at stone creekvillage at three oaksvillage at treemontvillage at volente ph 02village at walker placevillage at walker place phs 2village at walnut creek ph 01 sec 01 amdvillage at walnut creek ph 02 sec 10 amevillage at walnut creek ph 02 sec 18village at walnut creek ph 1village at walnut creek ph 2village at walnut creek phs 1 sec 1village at wells branchvillage at western oaksvillage at western oaks 06village at western oaks 08village at western oaks 09village at western oaks 10village at western oaks secvillage at western oaks sec 01village at western oaks sec 12village at western oaks sec 13village at western oaks sec 15village at western oaks sec 16village at western oaks sec 16-avillage at western oaks sec 17village at western oaks sec 17-avillage at western oaks sec 29-avillage at western oaks sec 33village at woodlakevillage avery park thevillage clear spgs #3 thvillage greenvillage grovevillage in the hillsvillage in the woodsvillage mayfield ranch ph 01village northvillage northwestvillage oaksvillage oaks 3village oaks sec 2village oaks sec 3village oak westvillage of ledge stone condovillage of mill creekvillage of mill creek #1 thevillage of riata ranchvillage of sage meadowsvillage of sage meadows phvillage of wimberleyvillage on congress condo amdvillage parkvillage park 4 at travis countvillage park 7 at travis countvillage park condo amdvillage park condosvillage ranchettesvillage ranchettes ph 1village river bendvillages/northpointe sec 3villages/westfield ph iivillage san leanna add 01village san leanna add 02villages at schwertner ranchvillages berry creekvillages berry creek sec 2avillages condovillage sec 02village sec 04village sec 05village sec 06village sec 07villages hidden lake ph 01villages hidden lake ph 02avillages hidden lake ph 02bvillages hidden lake ph 02b, villages of hidden lavillages hidden lake ph 03avillage shoresvillages of berry creek sec 03villages of berry creek sec 2bvillages of hidden lakevillages of hidden lake ph 3bvillages of hidden lake ph 3b thevillages of hidden lake ph 4avillages of hidden lake ph 4b thevillages of hidden lake ph 4cvillages of hidden lake ph 4c thevillages of hidden lake ph 5bvillages of hidden lake ph 6avillages of town centervillages of westcreekvillages on congressvillage south ph 01village south ph 01 sec 01village south ph 02village south ph 02 sec 01village south ph 04-b sec 02village twenty at anderson milvillage two at mockingbird hillvillage westvillage woodsvilla govallevillamantavillamanta condominiumsvilla montanavilla monte vistavillanova placevilla oaksvilla oaks subvilla paree condo ahvilla princesa edvillaret areavillaret estates iii subdvilla riovillas/marina del rey subvillas/star ranchvillas/star ranch condosvillas/star ranch condos sec 2villas/star ranch sec 22villas albanasvillasana horizonvillas anderson mill condos unit 1054a blvillas at canyon springsvillas at commanders pointvillas at flintrock sec 2 condovillas at hampton placevillas at harbor marina condomvillas at harbor marina condominiumvillas at hills amdvillas at holton woodsvillas at ingram hillsvillas at manor creekvillas at northgatevillas at pasadena condovillas at presidiovillas at roanokevillas at rough hollow south svillas at rowevillas at rowe condominiumvillas at siena creek condovillas at spring crevillas at star ranchvillas at the parkvillas at tuscan village amdvillas at vista ridgevillas coronado hills rev 1995villas del sol subvillas hillsvillas las floresvillas lost canyon condo amdvillas of chandler creekvillas of cresta bellavillas of elm creekvillas of manor creekvillas of oakcreekvillas of silverado hillsvillas of spring creekvillas of westcreekvillas of westlakevillas on lake travisvillas on travisvillas on travis condo amdvillas on travis condominiumvillas on walnut creekvillas on walnut creek thevillas travis heights condovilla suena sec 01villa suena sec 02villa tanglewoodvilla torrevill at woodlake cc jdvilla veramendi homesvilla westville d'alsaceville d alsacevine creekvine crk ph 3vine crk ph 3 & 4vine crk ph 3 &4vineyard/rough hollow condovineyard/rough hollow condosvineyard @ gruene iivineyard at blk house creekvineyard at florence sec 01vineyard at gruene iivineyard at rough hollowvineyard bay ph 01vineyard gruene iivineyard hillsvineyard hills ranch unrec subvineyard rdgvineyard rdg subvineyard ridgevinson estatevinson estatesvinstage oaksvintage farms sd#2vintage hillsvintage hills sec 02vintage hills sec 03vintage hills sec 04vintage hills sec 06vintage hills sec 07vintage oaksvintage oaks/the vineyardvintage oaks/the vineyard un 1vintage oaks/the vineyard un 2vintage oaks/the vineyard un30vintage oaks/vineyard un 28vintage oaks at the vineyardvintage oaks at the vineyard 1vintage oaks at the vineyard 6vintage oaks at the vineyard 8vintage oaks at the vineyard 9vintage oaks at the vineyardsvintage oaks ranchvintage oaks the vineyardvintage oaks the vineyard 1vintage oaks the vineyard 2vintage oaks the vineyard 4vintage spgs subvintage springsviolet crown heightsviolet crown heights sec 01violet crown heights sec 02violet crown heights sec 1violet crown heights sec 2 residencevirgil merrillvision parkvistavista acresvista acres subvista acres subdivvista acre subdivisionvista alegre 02vista al lagovista alta del veramendivista at 29 condovista bonitavista colinavista del nortevista del norte/oaksvista de los santos ph 2vista del riovista gardensvista grandevista grande condovista grande estatesvista grande sec 02vista hillsvista hills condovista hills condominiumvistanciavistancia sec 2vistancia sec 4vista oaksvista oaks corporate parkvista oaks rev 01a & 01bvista oaks rev 1avista oaks sec 01vista oaks sec 05avista oaks sec 1vista oaks sec 2avista oaks sec 2bvista oaks sec 4bvista oaks sec 5bvista pointvista pointe ph 1vista pointe sub ph 1vista point ph 2vista rdg ph 03vista rdg ph 2-a finalvista rdg ph 2bvista realvista ridgevista ridge estatevista ridge oaksvista ridge ph 01vista ridge ph 03vista ridge ph 04vista ridge ph 2vista ridge ph 2-bvistas/austin sec 2vistas/harold condosvistas at lake travisvistas at lakeway condovistas at lakeway condominiums amendedvistas at round mountainvistas at sanomavistas at sonomavistas of austinvistas of westcreekvista veravista vera condosvista verdevista viewvista westvista west 04vista west ranches unfiledvita foam subvitolich plazavivroux ranchesvizcayavizcaya (heritage)vizcaya (traditions)vizcaya ph 1 subvizcaya ph 4avizcaya ph 4cvizcaya ph 4dvizcaya ph 5evizcaya ph 6a subvizcaya ph 6cvogel lvogesvoges un 1voges un 2voight estatesvoigt estates 1voigt estates 2volentevolente heightsvolente peak ph 01von dohlen addvon ormyvon ormy heightsvon ormy ht/hilltop swvon rosenberg gardensvordenbaumvoss farmsvoss farms #2voss farms #3voss farms #4avoss farms #5voss farms 2voss farms and laubachvue/2222 condosvue at 2222v zepeda surww & ow0550wacowaco road west iiwaco road west subwadford st condoswaelderwaggener ranch 2waggener ranch comalwagon creekwagon creek estateswagon crossingwagon crossing sec 02wagon crossing sec 03-a amdwagon crossing sec 04wagon wheelwagon wheel sec 1wagon wheel subwahl farmwahl farmswakefieldw a king surv #451 abs466walburgwalden hts/crownridge nswalden squarewaldsangerwaldsanger subwalkerwalker, wm wwalker lolitawalker placewalker place phase 4 repl 2walker place phase 7 sec 1walker place phs 2walker ranchwalker wilson one-league grantwallacewallace, jas pwallace j pwallace jpwallerwalley creek ranchwalleye creek ranchwalling placewallingwood sec 02-awalliswallis fort bend call 158 tr 5wallisvillewalnut bendwalnut condominiumswalnut creekwalnut creek enclavewalnut creek enclave condominiwalnut creek enclave condominiumwalnut creek estateswalnut creek estates ph 8walnut creek estates ph fivwalnut creek estates ph ninwalnut creek estates ph twowalnut creek placewalnut crossing sec 01walnut crossing sec 03walnut crossing sec 05-awalnut estateswalnut estates 11walnut forestwalnut grove acreswalnut grove ranch acreswalnut heightswalnut heights east 3walnut heights east 4walnut hillswalnut hills sec 04walnut hills sec 05walnut passwalnut place sec 01walnut place sec 3walnut rdg iiwalnut ridge 01walnut ridge 02walnut ridge iiwalnut spgs ph 01walnut springswalnut springs ranchwalsh 360walsh 360 townhomeswalsh 360 twnhmswalsh placewalsh place div a amdwalsh ranch sec 03walsh ranch sec 04walsh trailswalsh trails sec 03walsh trails sec 4bwalsh trls sec 01walter c smith addwalterswalters, jacobwalters j bwaltonwalton bartelswalton condominiumswalton hillwalton izaakwalzem farmsw a matthews 3/4 league & labowanda brashear addwanda parkwandering oaksw a painterward & treadwellward addware addware c aware heightswa riggs surv abs #1046w a rinderknecht addwaringwarner ranchwarner ranch ph2warner ranch ph 2 sec 1warner ranch ph 2 sec 4warrenwarren addwarrior's legacywarriors legacywarriors legacy ph 2-bwarriors legacy ph 2-cwarriors legacy ph iwarriors path additionwarwick farmswashingtonwashington anderson addwashington heightswashington heights at chappell hillwashington lockhart surv a-2washington p reese surv abs #5washington squarewasser ranchwasser ranch 1wasser ranch un 3watch hillwater's edge condos bldg 3water's edge subdivisionwatercrest add ph fourwatercrest add ph onewaterfall on lake travis condowaterford/lk travis sec 04awaterford condo amdwaterford condominiums the awaterford condominiums the amendedwaterford heightswaterford on lake traviswaterford on lake travis sec. 3waterford on lake travis sec 01waterford on lake travis sec 02waterford on lake travis sec 1waterford on lake travis sec 2waterford on lake travis sec 3waterford on lake travis sec 4waterford on lake travis sec 6waterford parkwaterford place sec 02 amdwaterford village ph iwaterfront condowaterfront condominuimswaterfront parkwaterfront westwaterleafwaterleaf ph a sec 1waterleaf ph a sec 2waterleaf ph a sec 3awaterleaf ph a sec 3bwaterleaf ph a sec 4waterleaf ph a sec 5bwaterleaf ph b sec 01waterleaf ph b sec 1waterleaf ph b sec 4waterleaf ph b sec 5waterloowatermillwatermill sub ph 2watermill sub ph 3water oakwater oak northwater oak north sec 1water oak north sec 2water oak north sec 4water ridgewaters crossingwaters crossingswaters edgewaters edge - bexar countywaters edge 1waters edge 2waters edge condos bldg 3waters edge un 1waterside oaks condo amdwaterside on lake marble fallswaterstonewaterstone condowaterstone condominiumswaterstone condoswaterstone crossingwaterstone on lake travis condoswaterstone unit awaterstone unit cwaterstone villagewaterstone village twnhmswaterstreet loftswater street tier 1waters xingwater waywaterwaywaterwheelwaterwheel hilltopwaterwheel resortwaterwheel unit 1 phase 1waterwheel unit 1 phase 2waterwoodwaterwood subwaterwood un 1 cb 4131awaterwood unit 2water works landingwatkinswatkins sub 1watsonwatson lane estateswatson park 03watson placewatson w hwatterson estatewaugh waywaukegan way poawaverly estates #2w a woods sub #1w a woods sub #2waxahachiewaypoint landingwaysidewayside estateswayside oakswayside sub ph 1wayside sub ph 2wb rogersw c i d 17 02w cooper tracwc wilsonweweatherford heightswebb, ivan addwebb addnwebbervillewebberwood ridgewebberwood ridge sec 02webberwood sec 02webberwood sec 03webb h e subd no 3webers glenweb islewedgewoodwedgewood condowedgewood condominiumswedgewood professional bldgwedgewood sec 01wedgewood unit 4weichold rd n jd/ecweikel-schillerweikel-schiller 457weimarweirweir view estatesweiseweiss additionweiss addition phase twoweiss add ph fourweiss add ph oneweiss add ph threeweiss add ph twowelchwelchmeyer, j gweldon ranchwelfarewellesley manorwells, martinwells addnwells branchwells branch ph a sec 01wells branch ph a sec 03wells branch ph c sec 01wells branch ph c sec 02wells branch ph c sec 03wells branch ph c sec 04wells branch ph d sec 01wells branch ph d sec 02wells branch ph e sec 01wells branch ph e sec 02wells branch ph e sec 03wells branch ph gwells branch phs c sec 3wells branch phs w 2awells m j surwells point ph c-3 sec 02wellspringwellspringswells ranch ph 3wells ranch ph 4welsch addweltner farmswendlandt & muellerwendlandt & staehely resubwendler & schraderwentworthwerkenthin sec 03werkenthin sec 04werkenthin sec 05werth subdivisionwescott placeweslacowesley smith subdivisionwestwest #1west, c awest, jameswest/water streetwest 08 street condowest 10 street condo amdwest 35th street condowest addwest add 523west amity estates rep #1west annie street condowest austin tanglewood condowest ave condominiums amendedwest avenue condominiumswest ave place bl 642 un 2west bank subwest bastrop village ph 1 sec 1west bastrop village sec 1west bastrop village sec 1 ph 1westbrookwestbrook iwestbrook iiwestbury placewestbury sec 05west cameronwest campus cottages condo thewest canyon trls ph ivwest cave estateswest cave estate sec 01west cave estate sec 1west cave estate sec 2west cave estates sec 02west cave estates sec 04westchase villagewestchester parkwestchester park subwestcliff sec 01-awestcliff subwest columbiawest condo 904westcove villagewestcreekwestcreek/royal oakswestcreek/the oakswest creek/woods ofwestcreek bluffs nswestcreek landing condowestcreek oakswestcreek ph 03 sec 03westcreek ph 03 sec 04westcreek ph 03 sec 05westcreek phs 3 sec 1westcreek ranch condo amd phwestcreek ranch condominium amended phswestcreek sec 01 amdwestcreek sec 02westcreek sec 05westcreek sec 07westcreek sec 07 ph 01westcreek sec 2westcreek sec 10 ph bwestcreek sec 10 ph cwest cypress hillswest cypress hills ph 01 sec 02west cypress hills ph 1 sec 1west cypress hills ph 1 sec 2west cypress hills ph 1 sec 3west cypress hills ph 1 sec 4west cypress hills ph 2 sec 2west cypress hills ph 2 sec 3west cypress hills ph 2 sec 5west endwest end 3west end addwest end additionwest end addnwest end condowest end condo amdwest end on friowestenfield 01western annexwestern annex & w suggottwestern clstrs condowestern clstrs condoswestern divisionwestern heights port lavacawestern hillswestern hills 1st extwestern hills 1st phwestern hills 2nd phwestern hills 3rd extwestern hills 3rd phwestern hills 5th extwestern hills 6th extwestern hills 7th ext repwestern hills 8th extwestern hills addn revisedwestern hills at cherry creekwestern hills estates phs 11western hills estates revisedwestern hills estates revised sec 4western oakswestern oaks 03-cwestern rdg estates 11-bwestern ridge estates sec awestern trails of quail creekwestern trails of quail creekswestern trails of quail creek sec 5western trails quail creek sec 03 amdwestern trails sec 01western trails sec 02western trails sec 05western trails sec 06western trails sec 09western trails sec 9west farmwestfieldwestfield awestfield condowestfield condominiumswestfield developmenwestfield developmentwestfield development phase xiiiwestfield dev ph iwestfield dev ph xwestfield dev ph xiiwestfield dev ph xiiiwestfield dev ph xivwestfield plaza condo amdwestfield ranch - wilson countywestfortwestfort sawestgatewestgate at horseshoe baywestgate condo amdwestgate crossing condowestgate placewestgate place 1west gate squarewest gate westwest georgetownwest georgetown village 01west grove courtwesthavenwesthaven 1westhaven 2westhaven estates sec 01west haven of colony creekwesthaven ph 1west heaven subwest heightswestheim villagewesthill estates sec 01westhill estates sec 02west hills estatewest hillyard estateswesthoffwestlakewestlake condowestlake condominiumswestlake crossroadswestlake heights subdwestlake highlandswestlake highlands sec 02westlake highlands sec 05westlake highlands sec 06west lake hillswestlake hillswestlake madrones sec 02westlake oakswestlake parkwestlake park sec 02westlakeswestlakes un 8westlake villagewestlandwestland office parkwestlawnwest lawn areawest lawn area 5westline austinwest mainwestminster glenwest monroe add 1 pocwest moody farmswest oak condo amdwest oak estateswestoakswest oaks addwestoak sec 03westoaks resubwest oaks subweston oaksweston oaks ut-1westoverwestover bluff duplexeswestover crossingwestover crossing pudwestover elmswestover hillswestover hills/reserve meadowswestover hills sec 01westover hills sec 03westover hills sec 03 ph 03westover hills sec 03 ph 04westover hills sec 04westover parkwestover placewestover ridgewestover subwestover valleywestover villa resubwestover woodswest park addwest park amdwest park estateswestpark phase onewestpark ph onewestpark ph threewestplace condowestplace condominiums thewest pointwest point 535westpointewestpoint eastwestpointe eastwestpointe east un 33 ph 7westpointe fronterrawest pointe gardenswestpointe northwestridgewest ridge estateswestridge estateswest ridge ph ixwest ridge ph viwestridge placewest ridge sec 04west ridge sub ph iwest rimwest r surwest shorewestside ext addwestside extensionwestside landing / rough hollowwestside preserve between lakeline and andersonwest universitywest university place condominiumswest viewwestviewwestview addn gvwestview circlewestview condowestview estateswestview estates sec 03westview gatesvillewest view heightswestview mdws ph 02 finalwestview mdws ph 03 finalwestview meadowswestview meadows ph 01westview meadows ph 02westview meadows ph 03westview meadows ph 04westview on lake austin ph cwestview on lake austin ph c sec 03westview on lake austin ph c sec 05west view rep ph iiiwestview shadowswest village at creek sidewest village at creeksidewest village at creekside 2west village at creekside 5west village at creekside 7west vlg/creekside un 7west vlg/creekside un 9westward pointe 2west water streetwestwindwestwinds-summit at alamo ranchwestwind sec 01 amd ofwestwind sec 02westwinds lonestarwestwind sub sec 3westwoodwestwood condowestwood dev ph iiwest wood estateswestwood fieldswestwood parkwestwood sec 01westwood sec 02westwood sec 03westwood sec 04westwood sec 06westwood sec 07westwood sec iwestwood villagewestwood villaswestwood villas sec 01w g koehlerwg lord addwhartonwhartons dockwhatley acres replat no. 1wh bynum surv abs 6wh colew h cole a02010bcw h daviswheatley heightswheeler creek villagewheelock g rwhisperwhisper creekwhisper fallswhisper hollowwhisper hollow condos bl 16957whispering creekwhispering hillswhispering hollowwhispering hollow ph 1 sec 1whispering hollow ph 1 sec 2awhispering hollow ph 1 sec 3whispering hollow ph 1 sec 7awhispering hollow ph 1 sec 7bwhispering hollow ph i sec 4awhispering hollow ph i sec 5cwhispering meadowswhispering oakswhispering oaks 01whispering oaks 03whispering oaks 04whispering oaks condowhispering oaks estateswhispering oaks subwhispering oaks subdwhispering pineswhispering sandswhispering valleywhispering valley condo amdwhispering windwhispering windswhispering woodswhisper meadowwhisper meadowswhisper mixed use sub ph 1awhisper mixed use sub ph 1bwhisper mixed use sub ph 2whisper oakswhisper oaks condoswhisper residentialwhisper southwhisper south-unit 1 subwhisper valleywhisper valley ph iiiwhisper valley villagewhisper valley village 1 ph 1whisper valley village 1 ph 2whisper vly village 1 ph 2whisper vly vlg 1 ph 2whisperwindwhisperwind - comalwhisperwind 2whisperwind 3whisper wood 01whitewhite bluff #01white bluff #18white bluff #35white bluff interior northwhitecliff condominia ph 01 amdwhitecliff condominia ph i amwhitehall/buckhorn cemeterywhitehurst, j.h.white k bwhite oakwhite oak estates 03white oak preservewhite oak preserve sec fourwhite oak preserve sec twowhite plains sec 02white plains sec 03white plains sec 3 resub of lowhite rim mountain sec 01white rock esateswhite rock estateswhite rock estates ph eightwhite rock estates ph fivewhite rock estates ph fourwhite rock estates ph onewhite rock estates ph sevenwhite rock estates ph six swhite rock estates ph tenwhite rock estates ph threewhite rock estates ph twowhite rocks entertainmentwhiteswhite settlementwhiteside geo or parkwood rancheswhitesides, geo wwhitestone assembly of godwhitestone landingwhitestone oakswhitestone oaks at andersonwhitestone oaks at anderson millwhitetailwhite tail acreswhitetail ranchwhitetail resubwhitetail ridge subwhitetail ridge subdivision, falcon ridge ranchwhitetall rdg subwhitewater spgswhitewater springswhitewater subwhite wingwhite wing enclavewhite wing ph #2white wing phase #1white wing phase #1 - guadalupewhitewing vistawhitiswhitis subdwhitmire estateswhitneywhitsettwhit subwhitten placewhittington, t mwhittlesey, ralphwhitt ranchwh tobins subwichita fallswi daniels sub county bl 5122wi jackson surv #322b abs #153wilburn, matildawilco ranch ph 2 sec 1wilco ranch ph 2 sec 2wilco ranch ph 3 sec 2wilcoxwildcat club subwilderwilder add sec 01wilderness covewilderness estateswilderness pointewildewood acreswildflower country clubwildflower country club cloverwildflower country club phwildflower country club pt owildflower sec 01wildflower sec 04wildflower trailwildflower villagewildhorsewildhorse at tausch farmswildhorse creek commwildhorse creek sec 01wildhorse creek sec 03wild horse overlookwild horse ranchwildhorse ranchwildhorse vistawildhosewildleafwildleaf ph 3wild plum estateswild plum valleywild ridgewild rock, crystal fallswild rock residential condominiumswild rock residential condominiums, crystal fallswild rock residential condoswildspring - arbor collectionwildspring - grove collectionwild windwild wind 3wild wing preservewildwoodwildwood estateswildwood estates phase fourwildwood estates ph onewildwood estates ph threewildwood estates ph twowildwood iiwildwood onewildwood rancheswiley creek estateswiley harris abs 298wilke acreswilke roadwilkersonwilkerson estateswilkins subwilkirsonwilla communitywillbert addwillettwilliam allen surv abs #24william arringtonwilliam cockburnwilliam h. clemonswilliam haggard leaguewilliam haggard league 30 abs8william harriswilliam h haggardwilliam hillwilliam j barker surv abs #65william joneswilliam leachwilliam mancil surv #437william p. reese survey #13 abstract #750william p baxter surv abs #118william pharris svwilliam p reese surv #13 abs #william price surv abs #364william rabb 3 league a-86william rabb 3 leauge a-86william reesewilliam r williamswilliam ryan surv abs #375williamswilliams, samlwilliams addwilliamsburgwilliamsburg meadowswilliamsburg s/s unit iiiwilliamsburg sq condoahwilliamsburg sub unit iiiwilliams creek ph 04williams creek ranchwilliams family subwilliams h b -b/villewilliam s hotchkisswilliam s hotchkiss surv 16 abwilliam simmonswilliams lane acreswilliam small league & labor awilliamson addn sec 2 & resuwilliamson add sec 2 & resubswilliamson countywilliamson creekwilliamson creek sec 01-awilliamson creek sec 02williamson creek subd sec 2williamson sec 02williamson subd sec 2williams parkwilliam s stillwell abs #564williams subwilliam wardwilliam w lewis surv abs #a0300william wofford surv 39 abs 8william woodford surv abs #22willie f stefekwilliswillis ranchwillmann estateswillowbend 1st unit sec 2willowbend estateswillowbend estates amdwillow branch loftswillowbreeze farmwillow bridgewillowbridgewillow brookwillowbrookwillowbrook north twnhmswillow citywillow city loopwillow creekwillow creek 4willow creek 6willow creek developmentwillow creek estateswillow creek estates sec 10-bwillow creek estates sec 11willow creek estates sec 12willow creek iwillow creek sec 01willow creek sec 1 resub lt 13willow est./meadowviewwillow glennwillow grovewillow grove sub (sc)willow havenwillow meadows sec 16willow moon ranch addwillow parkwillow pointwillow ridgewillow ridge add ph onwillow ridge add ph thwillow ridge add ph twwillow ridge sub phwillow runwillow run sec 01willow run sec 06willow run sec 07willow run sec 08willow run sec 10-awillow run sec 10awillowswillow spgs sec 01willow springswillow springs sec 1willows thewillow tracewillow viewwillow view unit 1willow wood @ shavano parkwillow wood estateswillshire village (ne)wilma's waywilshirewilshire parkwilshire terracewilshire terrace newilshire villagewilshire village newilshire wood sec 01wilsonwilson's preservewilson addwilson and kennedy additionwilson flatswilson gardenswilson rogerswilson s iwilson st subwilson tracewilson trace condoswimberleywimberley hillswimberley hills sec 1wimberley hills sec 2wimberley oakswimberley ranch estateswimberley spgs sec 1wimberley springswinans creek ranchwinchesterwinchester condowinchester hillswindbornewindborne 100windbrookwindcrestwindcrest gdn hmwindcrest ph iwindcrest ph iiwindcrest seg 3windcrest sub ph iiwindcrest sub ph iiiwindermerewindermere airparkwindermere oakswindermere park garden villaswindermere ph a sec 01windermere ph bwindermere ph cwindermere ph dwindermere ph ewindermere ph f sec 01windermere ph f sec 02windermere ph f sec 03windermere ph g sec 01windermere ph h sec 01windermere ph h sec 02windermere phs a sec 1windfieldwindfield condominiumswindfield estates ph 5windfield estates ph onewindfield estates ph sixwindfield estates ph twowindfield unit 1windfield unit1wind gate ranchwind gate runwinding brookwinding creekwinding creek ranchwinding creek sub'dwinding crk ranch un 1winding crk ranch un 2winding oakswinding trails ph 01windmillwindmill addwindmill bluff estateswindmill estateswindmill farms phase onewindmill farms ph iiwindmill farms ph iiiwindmill farms ph onewindmill hill subwindmill hollowwindmill ranchwindmill ranch 4windmill ranchetteswindmill run sec 01windmill run sec 02-awindmill run sec 03-awindmill run sec 03-dwindridgewindridge addwindridge sec 01windridge sec 02-awindridge village repwindrock condo amdwindsongwindsong estateswindsor heightswindsor hills sec 01windsor hills sec 03windsor hills sec 04windsor hills sec 05windsor hills sec 07windsor oakwindsor oaks condo amdwindsor oaks quadswindsor parkwindsor park 02 sec 01windsor park 02 sec 02windsor park 02 sec 04windsor park 03 sec 02windsor park 03 sec 03windsor park hills sec 01windsor park hills sec 04windsor park sec 01windsor park sec 02windsor park sec 03awindsor park sec 4awindsor placewindsor road/forest trail condowindsor villagewindswept acreswindswept acres sec 2windtree condo amdwindtree condominiums amendedwindwood eswindwood estateswindy covewindy hillwindy hill ranch sub rwindy hill sub -11 acwindy hill sub -24 acwindy knollwindy park sec 1windy park sec 2windy terrace industrial office warehouse condoswindy trailswinfield condowinfield estates ph fourwinfield parkwinfordwinnbrook estateswinners circlewinners circle addwinnie mae addwinnsborowinterfellwinters & furrwischkaemper road subwitcher & willets addwithers addwithers j bw j hallmarkwj mills surv 19 abs 388wm. m. eastlandw martin s to w commerce (sa)w mauldin surv abs # 546wm dicksonwm j baker surveywm johnswm johnsonwm johnson acreswm mullenwmt subdivisionwm wellswolf creekwolf creek ranchwolf creek sub ut-4wolfe rd bus parkwolf ranchwolf ranch - 60'wolf ranch - 70'wolf ranch - claremontwolf ranch - west bendwolf ranch south forkwolf ranch westwolf ranch west bendwolf ranch west ph 1 sec 3wolf ranch west ph 1 sec 3 subwolf ranch west ph 2 sec 2wolf ranch west ph 2 sec 3wolf ranch west ph 2 sec 4bwolf ranch west ph 3 sec 1awolf ranch west ph 4 sec 6wolf ranch west sec 1bgwolf ranch west sec 2 ph 2wolf ranch west sec 2gwolf ranch west sec 4awolf ranch west sec 4gwolf ranch west sec 5wolf ranch west sec 7bwoller creekwomack add sec 01wonder homeswood, mandredwood acreswoodbridgewoodbridge at monte viejowoodbridge creek phase iiiwoodbridge creek ph iiwoodbridge creek ph iiiwoodbridge farmswoodbridge farms un 3woodbridge sec 03woodbrookwoodbrook sub ph 2woodbury sq condowoodcliff amdwoodcreekwoodcreek - ph 2woodcreek iiiwoodcreek sec 08woodcreek sec 1woodcreek sec 2woodcreek sec 3woodcreek sec 4-cwoodcreek sec 5woodcreek sec 6-cwoodcreek sec 7woodcreek sec 8woodcreek sec 9-awoodcreek sec 9-bwoodcreek sec 9awoodcreek sec 12woodcreek sec 13woodcreek sec 14woodcreek sec 16woodcreek sec 19woodcreek sec 20woodcreek sec 21woodcreek sec 22woodcreek sec 25woodcreek spgs sec 1woodcreek springs sec 1woodcreek subdivisionwoodcreek villagewoodcreek village eleven sec 1woodcreek village sec 1woodcreek village sec 6woodcrestwoodcrest-awoodcrest sub ut-14woodfield preservewoodfield preserve ph 1woodfordwoodford condowoodford condoswoodford estateswoodford gardenswoodford saladowoodford westwood glenwoodglenwood glen jdwood glen sec 01 ph 01-a amdwood glen sec 01 ph 02wood glen sec 02 ph 01wood glen sec 03wood glen sec 04 ph 01wood glen sec 05 ph 02wood glen sec 06wood glen sec 08woodgreen acreswoodhavenwoodhaven 02wood hollowwoodhollowwoodlakewoodlake #1woodlake #2woodlake #4woodlake#4woodlake bluffs enclavewoodlake estateswoodlake golf villaswoodlake golf vistawoodlake jdwoodlake meadowswoodlake parkwoodlake park subwoodlake ph 03woodlake ph 04woodlake ph 06woodlake ph 6woodlake trailswoodlandwoodland bills sec 3woodland estates sec ii ph bwoodland forestwoodland heightswoodland heights & extwoodland heights ext 3woodland hillswoodland hills northwoodland hills sec 01woodland lakes 03 magwoodland manorwoodland oakswoodland oaks sec 01awoodland oaks villagwoodland parkwoodland park ph 01-bwoodland park ph 1woodland park ph 3woodland park west ph 2woodland ranch estateswoodlandswoodlands # 2woodlands 02 condowoodlands 4woodlands 19woodlands 21woodlands 22woodlands ii condowoodlands of caminowoodlands of college station condoswoodlands of garden ridge - comalwoodlands parkwoodlands park ph 1woodlands park ph 2woodlands park ph 3woodlands park ph 4awoodlands sec 01 thewoodlands sec 02 the repwoodlands sec 03 thewoodlands sec 04 thewoodlands sec 06woodlands sec 6woodlands subdivisionwoodlands thewoodland trailswoodland trails iiwoodland village anderson mill sec 01 blkwoodland village anderson mill sec 02 ph 01woodland village anderson mill sec 02 ph 02woodland village anderson mill sec 03 blkwoodland westwoodlawnwoodlawn addwoodlawn hillswoodlawn lakewoodlawn parkwoodlawn place condowoodlawn terracewoodleywoodmont townhomeswoodmont twnhmswood ranchwood ranch sec 01 amdwood ranch sec 04 amdwoodridgewoodridge estateswoodridge parkwoodridge villagewood road addwoodrose placewoodrowwoodrow lee subwoodrow place twnhmswoodrow ranchwoodrow square condo amdwoodrow square condoswoods, leanderwoods/four pointswoods/great oakswoods/st claire un 3woods/westcreek un 4woods at berry creekwoods at berry creek sec 02woods at berry creek sec 03woods at carriage hills sec 01woods at carriage hills sec 2woods at crystal falls sec 01woods at four pointswoods at great oaks condowoods at sonterrawoods berry creek ph 01woodsborowoods brushy creek sec 01woods brushy creek sec 01 amdwoods brushy creek sec 02 ph 01-awoods brushy creek sec 02 ph 04woods brushy creek sec 06 ph 02woods brushy creek sec 07woods brushy crk sec 02 ph 03woods brushy crk sec2 ph4woods century park sec 01woods century park sec 02woods endwoods fountainwoodwoods fountainwood ph 01bwoods fountainwood ph 07woodsidewoodside condo nswoodside farmswoodside farms sub un 2woodside villagewoods isaacwoods knoll addwoods lake travis 01woods lake travis sec 02woods legend oaks sec 01woodslopes lost creek condo amwoodslopes lost creek condoswoods of alonwoods of brushy creekwoods of century parkwoods of century park sec 1woods of deerfieldwoods of encino parkwoods of frederick creekwoods of greenshoreswoods of greenshores sec 01woods of lake traviswoods of legend oakswoods of shavanowoods of west creekwoods of westcreekwoods of westlake heightswoodson terracewoods sec 01woods sec 02 amdwoods sec 04woods sec 05a pt vacation sec 05woods the sec 1woodstonewoodstone hillswoodstone villagewoodstone village sec 01woodstone village sec 02woodstone village sec 03woodstone village sec 04woodstone village sec 06woods westlakewoods westlake hilltopwoods westlake hilltop 02woods wimbledon sec 01woodthornwood trail estateswood valleywood valley acrewood valley acreswoodvalley acreswoodview at bulverde crewoodwardwoodward indust districtwoodward industrial districtwoodwaywoodway 2-bwoodway iwoodway ii-awoodwillow addwoodwork addwoolridgewootenwooten goodallwooten parkwooten park sec 01wooten park sec 02wooten park sec 03wooten park sec 04wooten park sec 05wooten park squarewooten terrace sec 01wooten terrace sec 01-awooten terrace sec 02wooten terrace sec 03wooten terrace sec 3wooten village sec 01wooten village sec 02wooten village sec 04wooten village sec 05wooten village sec 06workspace usa georgetown #1 coworley add sec 02wortham oaksw p hardemanwrenbar addwren valley sec 01-awrightwright, jemimawright addwrightsborow r smithwr woods sub 13w s chapman addw s s addw s turner surv 122w t chapman #3wt jolly surv #54 abs # 2339w t roachwunderlichwurzbach heights townhousewurzbach meadowwurzbach meadowswurzbach meadow twnhs subwurzbach towerswurzbchtwrw van dykewww w lewis grammar schoolw w lewis henderson-arnoldw w lewis higbeew w lewis northwestw w lewis surv abs #300wyldwood estateswyldwood sec 01w y mcfarlandwyndham hillwyndham hill addwyndham hill additiowyndham hill add ph 1wyndham hill add ph iiwyndham hill add ph ivwyndham hill add ph vwynnbrookwynn wood condowynnwood condominiumwynnwood condos nswynwood of westcreekwynwood place at westcreekx003llli - thrall isd vacant lnd/abstx0063301 - thrall isd non-cityxspacexspace condominiumsxspace condosyanceyyancey port lavacayarrabee bend south sec 01yarrellton ranchesyaupon creek sec 01 amd lakewayyaupon ridge amdyeigh family acresyellowstoneyellowstone a1yesykm heightsyoakumyoakum t/syo ranchlandsyork creek estatesyork creek meadow iyork creek meadowsyork creek ranchyork townyorktownyorktown heights annexyorktown ranchyorktown t/h condoyoung, richardyoung health services subyoung schlueter addyoung subyoung williams surv abs #861yowell ranchyowell ranch ph 5yowell ranch phase viyowell ranch ph ivyowell ranch ph iv first amyowell ranch ph oneyowell ranch ph threeyowell ranch ph twoyowell ranch ph vyowell ranch ph viyowell ranch ph viiyr1 rural area 3yr2 rural area 9z50005zachary scott sec 02zaidan crossingzambranozamora estateszapatazarazarephathzarzazarzamorazarzamora htzella buergerzella jones addzephyrz griffithz hinton abs 0220z hinton surveyz hinton survey abs 0220z hinton survey abs 220zidellzieschangzilkerzilker - frazier addzilker condo amdzilker flats condominiumszilker on park condominiums/zilker park residenceszilker park residenceszilker reserve condominiumszilker terrace condozilkrzilkr/pk condozilkr/pk condoszilkr on the parkzilkr on the park condominiumzilkr on the park condominiumszilkr on the park condoszipp #1zipp - koepselzoppp addzuehl flying communityz williamson #2z williamson #3z williamson surv_3400_tacrew
Any
Loading in progress…
No results found
Please start typing…
Any
Search

AI Search. Tell me what you're looking for!

Selected Filters:
Clear All Filters
73813 results found
Price
BedsSqftLot SizeBathsPriceYear BuiltCreated AtTotal ImagesDays on the Market
Descending
DescendingAscending
12
122448
Search Results
$63,000,000
19101 Veranda, Lago Vista, TX, 78645
ACTIVE
MLS# 5200716

Listing Agent: Judi Barrett

Listing Office: Barrett International Real Est

Search Results
$58,950,000
0 Lohman Ford, Lago Vista, TX, 78645
ACTIVE
MLS# 4376523

Listing Agent: Ryan Winn

Listing Office: Keller Williams Realty C. P.

Virtual Tour
Search Results
$58,950,000
0 Lohman Ford Road Lohman Ford, Lago Vista, TX, 78645
ACTIVE
MLS# 7103639

Listing Agent: Ryan Winn

Listing Office: Keller Williams Realty C. P.

Newly Listed
Search Results
$49,300,000
2884 Political Road, Lockhart, TX, 78644
2,852 Sq ft
ACTIVE
MLS# 614513

Listing Agent: Kaylee Sutton

Listing Office: Land Unlimited

Newly Listed
Search Results
$49,300,000
2884 Political Road, Lockhart, TX, 78644
2,852 Sq ft
ACTIVE
MLS# 614514

Listing Agent: Kaylee Sutton

Listing Office: Land Unlimited

Newly Listed
Search Results
$49,300,000
2884 Political Road, Lockhart, TX, 78644
2,852 Sq ft
ACTIVE
MLS# 605990

Listing Agent: Kaylee Sutton

Listing Office: Land Unlimited

Search Results
$49,300,000
2884 Political, Lockhart, TX, 78644
4
4
2,852 Sq ft
ACTIVE
MLS# 1270473

Listing Agent: Kaylee Sutton

Listing Office: Land Unlimited

Search Results
$49,300,000
2884 Political, Lockhart, TX, 78644
ACTIVE
MLS# 9287740

Listing Agent: Kaylee Sutton

Listing Office: Land Unlimited

Search Results
$49,300,000
2884 Political, Lockhart, TX, 78644
ACTIVE
MLS# 3991993

Listing Agent: Kaylee Sutton

Listing Office: Land Unlimited

Search Results
$43,945,000
1033 Flying X, Spicewood, TX, 78669
ACTIVE
MLS# 3554985

Listing Agent: Andrew Senter

Listing Office: Moreland Properties

Virtual Tour
Search Results
$41,000,000
9151 Ranch Road 2338, Georgetown, TX, 78633
PENDING
MLS# 3465198

Listing Agent: Tom Sloan

Listing Office: Sloan Schultz Chisholm Trl Prp

Search Results
$39,951,054
1107 Silent Valley, Lockhart, TX, 78644
ACTIVE
MLS# 1328352

Listing Agent: Taylor Golden

Listing Office: Gold Tier Real Estate, LLC

No results found

Please remove some of the selected filters.
1 2 3 … 6,152
Listing information provided courtesy of the Central Texas MLS. IDX information is provided exclusively for consumers' personal, non-commercial use, and it may not be used for any purpose other than to identify prospective properties consumers may be interested in purchasing. The data is deemed reliable but is not guaranteed accurate by the MLS. Updated: 25th June, 2026 5:40 PM (UTC)
Based on information from the Austin Board of REALTORS (alternatively, from ACTRIS). All information provided is deemed reliable but is not guaranteed and should be independently verified. The Austin Board of REALTORS, ACTRIS and their affiliates provide the MLS and all content therein "AS IS" and without any warranty, express or implied. Copyright © Austin Board of Realtors Updated: 25th June, 2026 5:46 PM (UTC)
Search Results
Listing information provided courtesy of the LERA MLS. IDX information is provided exclusively for consumers' personal, non-commercial use, and it may not be used for any purpose other than to identify prospective properties consumers may be interested in purchasing. The data is deemed reliable, but is not guaranteed accurate by the MLS. Updated: 25th June, 2026 5:48 PM (UTC)
ABR
BPOR
EPRO
MRP
SRS
ABR
BPOR
EPRO
MRP
SRS
inception-app-prod/MmY4YTJkNDMtMjhmNC00YmRjLTk1YTMtMDlmYWU5NGJmNWY4/content/2025/05/dcecd6a02268ad901ee9ff3b5f343f6e834ad7f8.jpg

Office Address

Hill Country Listings
181 NewportCanyon LakeTX 78133US
(830) 708-4247
stormy.sparkman@hotmail.com

Essentials

  • About
  • Search Results
  • Featured listings

Explore Communities

  • Blanco
  • Canyon Lake
  • Fischer
  • New Braunfels
  • San Marcos
  • Wimberley

Consumer Protection & Privacy

  • DMCA Compliance
  • Accessibility
  • Information About Brokerage Services
For ADA assistance, please email compliance@placester.com. If you experience difficulty in accessing any part of this website, email us, and we will work with you to provide the information.
Hill Country Listings | Central Texas Real Estate – Homes, Ranches & Investments logo

© 2026 All rights reserved

Created with Placester

Get in touch

Send
Succes! Your message was sent!
Great! Someone will be in touch with you shortly!
Back to homepage
Oops! Error occurred.
Please try again.
Back to form
Already a User? Sign In

Sign In

Sign in with your email address

Sign In
Success! Your message was sent!
Thanks for your message, we will contact you soon.
Back to homepage
Oops! Error occurred.
Please try again.
Back to form
Forgot your password?
Create an account
You have been successfully logged in
The page will reload automatically.
Go to the homepage
Sorry something went wrong
Login or password are incorrect. Please try again.
Try again

Sign Up

Your password needs:
At least one uppercase letter
At least one special symbol or number
At least 8 characters
Sign Up
Success! Your message was sent!
Thanks for your message, we will contact you soon.
Back to homepage
Oops! Error occurred.
Please try again.
Back to form
Already a User? Sign In
You have been successfully registered
Please check your email.
Go to the homepage
Sorry something went wrong
Please try again.
Try again

Reset password

Reset password
Return to Log In
Reset password email has been sent.
Go to the homepage
Sorry something went wrong
Please try again.
Try again

Change password

Your password needs:
At least one uppercase letter
At least one special symbol or number
At least 8 characters
Change password
Sign Up
Your password has been successfully reset.
Go to the homepage
Sorry something went wrong
Please try again.
Try again

Account verification in progress

Account Verified!
The page will reload automatically.
Go to the homepage
Verify your email address
In order to log in to your account, you need to confirm your email address. Please check your inbox!
Go to the homepage

Share this listing

Copy Link

Hold on!

You’re being redirected to the page with listing data.

You have been successfully logged in.
The page will reload automatically.
Sorry something went wrong.
The page will reload automatically.